IL-13 Protein, Human (HEK293, His)
Based on 29 publication(s) in Google Scholar
IL-13 Protein, Human (HEK293, His) is a cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. IL-13 Protein, Human (HEK293, His) is a recombinant human interleukin-13 (rhIL-13) expressed in HEK 293 cells with a His tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IL-13 Protein, Human (HEK293, His) is a cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. IL-13 Protein, Human (HEK293, His) is a recombinant human interleukin-13 (rhIL-13) expressed in HEK 293 cells with a His tag.
Background
Interleukin-13 is a cytokine which is secreted by activated T lymphocytes and primarily impacts monocytes, macrophages, and B cells. The circular dichroism spectrum confirms that interleukin-13 belongs to the alpha-helical family of cytokines. Interleukin- 13 affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation, Ig class switching to IgE synthesis, and enhanced production of IgG4 and IgM. In human macrophages and monocytes,hIL-13 has been shown to inhibit HIV replication. Human IL-13 also inhibits proinflammatory cyto-kines induced by LPS exposure, indicating poten-tial therapeutic applicationsas an anti-inflammatory agent[1].
Verified Bioactivity
1. The cell proliferation assay using TF-1 human erythroleukemic cells has an ED50 value of 0.7429-8.61 ng/mL.
2. Loaded Lebrikizumab (HY-P99025) on AHC2 biosensor, can bind IL-13 Protein, Human (HEK293, His) with an affinity constant of 7.283E-10 M as determined in BLI assay.
3. Loaded IL-13 Protein, Human (HEK293, His) on NTA biosensor, can bind Lunsekimig (HY-P990748) with an affinity constant of 2.806E-09 M as determined in BLI assay.
MCE Validation Data
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
-
Bioactivity - BLI
Bioactivity - BLI
-
Bioactivity - BLI
Bioactivity - BLI
-
Bioactivity - BLI
Bioactivity - BLI
Publications (29)
-
Journal Impact Factor
-
Most Recent
-
-
J Nanobiotechnology
An ischemia-homing bioengineered nano-scavenger for specifically alleviating multiple pathogeneses in ischemic stroke. [Abstract]2022 Aug 31;20(1):397. PMID: 36045405 -
Research (Wash D C)
NIR-Activated ICG-Loaded M2 Macrophage Exosomes Ameliorate Periodontitis via Targeting Infection Inflammation and Oxidative Stress. [Abstract]2026 Apr 27:9:1207. PMID: 42051363 -
Cell Death Dis
Circulating mitochondrial DNA promotes M2 polarization of tumor associated macrophages and HCC resistance to sorafenib. [Abstract]2025 Mar 4;16(1):153. PMID: 40038250 -
Cancer Lett
Targeting C/EBPβ/SCD1/C16:1 loop-driven macrophage M2 polarization by Bruceine D improves anti-PD-1 immunotherapy in colorectal cancer. [Abstract]2026 Sep 28:656:218655. PMID: 42250753 -
J Allergy Clin Immunol
Eosinophilic chronic rhinosinusitis with nasal polyps: Squamous metaplasia as an associated remodeling feature. [Abstract]2026 Feb 26:S0091-6749(26)00131-4. PMID: 41759748 -
J Allergy Clin Immunol
Cigarette smoke-induced epithelial cell ferroptosis promotes neutrophilic inflammation in patients with nasal polyps. [Abstract]2025 Jun;155(6):1882-1897. PMID: 40086488 -
Allergy
Acetylcholine From Solitary Chemosensory Cell, Not Neuron, Regulates Basal Cell Fate Driving Eosinophilic Chronic Rhinosinusitis With Nasal Polyps. [Abstract]2025 Sep 15. PMID: 40951952 -
Cancer Genet
2025 Nov:298-299:285-294. PMID: 41265012 -
Dev Cell
Vimentin intermediate filaments coordinate actin stress fibers and podosomes to determine the extracellular matrix degradation by macrophages. [Abstract]2025 Jun 23;60(12):1669-1685.e6. PMID: 39952241 -
J Ethnopharmacol
Zhichuanling oral liquid attenuates airway inflammation in asthma by targeting the STIM1/CHOP/JNK axis. [Abstract]2026 Feb 10:356:120859. PMID: 41197928
IL-13 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: J Ethnopharmacol. 2026 Feb 10:356:120859. [Abstract]
IL-13, Human (HEK293, His) (10 ng/mL; 12-36 h). Expression levels of the key protein STIM1 detected by western blotting in BEAS-2B cells treated with various concentrations of LPS combined with IL-13 at three different time points, used to select the optimal modeling dose and treatment duration.
-
Cell Biosci
Differential effects of PGAM5 knockout on high fat high fructose diet and methionine choline-deficient diet induced non-alcoholic steatohepatitis (NASH) in mice. [Abstract]2023 Aug 21;13(1):154. PMID: 37605246
IL-13 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Cell Biosci. 2023 Aug 21;13(1):154. [Abstract]
IL-13, Human (HEK293, His) (20 ng/mL; 24–48 h). Differentiated THP-1 cells were stimulated with LPS + IFNγ or IL-4 + IL-13 and treated with NC or PGAM5-siRNA for 24–48 h. a–d Levels of TNF-α (a), IL-1β (b), IL-6 (c), and IL-10 (d) secreted into the culture medium.
-
Inflamm Res
Aldosterone induces renal lymphangiogenesis through macrophage-lymphatic endothelial cell transformation and Inhibition by esaxerenone. [Abstract]2025 May 24;74(1):85. PMID: 40413281 -
Cells
Upregulated Hexokinase-2 in Airway Epithelium Regulates Apoptosis and Drives Inflammation in Asthma via Peptidylprolyl Isomerase F. [Abstract]2025 Jul 1;14(13):1004. PMID: 40643524 -
Cancer Immunol Immunother
Integrating necroptosis and immune landscapes: a multi-omics-derived NecropImmScore stratifies prognosis and therapy in ovarian cancer. [Abstract]2025 Oct 15;74(11):340. PMID: 41094064 -
Int Immunopharmacol
Cucurbitacin B suppresses malignant progression of oral leukoplakia via ferroptosis-induced macrophage polarization. [Abstract]2025 Sep 13:165:115485. PMID: 40946669
IL-13 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2025 Sep 13:165:115485. [Abstract]
IL-13, Human (HEK293, His) (20 ng/mL; 48 h). THP-1 monocytes were induced with PMA for 48 h to obtain M0 macrophages, followed by the addition of IL-4 and IL-13 for 48 h to induce polarization of M0 macrophages towards M2 macrophages. Flow cytometry analysis of CD163 expression levels in M0 macrophage and M2 macrophage.
-
Biol Direct
Prognostic and immunological implications of protein kinases in gastric cancer: a focus on hub gene ABL2 and its impact on the polarization of M2 macrophages. [Abstract]2025 Mar 24;20(1):35. PMID: 40128818 -
Arthritis Res Ther
Omentin-1 reduced synovial M1 macrophages through SIRT6 signaling pathway and alleviated knee osteoarthritis response in mice. [Abstract]2025 Nov 18;27(1):216. PMID: 41254811
IL-13 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Arthritis Res Ther. 2025 Nov 18;27(1):216. [Abstract]
Western blot was used to determine the relative expression of Omentin-1 protein in Raw264.7 cells. Omentin-1 promoted the transformation of Raw264.7 cells into the M2 phenotype while inhibiting the conversion to the M1 phenotype. Raw264.7 cells were induced to differentiate into M1 macrophages by LPS (10 pg/mL) and IFN-γ (IFN-gamma Protein, Human (CHO); 20 ng/mL) for 24 h, while they were induced to differentiate into M2 macrophages by IL-4 (20 ng/mL) and IL-13 (20 ng/mL). After 24 h, Omentin-1 was added to the cell culture medium, and the incubation was continued for an additional 24 h
-
Front Cell Dev Biol
Tumor Cell-Derived Exosomal miR-770 Inhibits M2 Macrophage Polarization via Targeting MAP3K1 to Inhibit the Invasion of Non-small Cell Lung Cancer Cells. [Abstract]2021 Jun 14:9:679658. PMID: 34195198 -
Poult Sci
Matrine disturbs the eimeria necatrix-induced loop of tuft cell-intestinal stem cell-goblet cell by inactivating IL-13/JAK2/STAT3 signaling. [Abstract]2025 Jan 10;104(2):104786. PMID: 39798285 -
Drug Dev Res
Knockdown of IGF2BP3 inhibits the tumorigenesis of gallbladder cancer and modifies tumor microenvironment. [Abstract]2022 Dec;83(8):1831-1844. PMID: 36184877 -
J Trace Elem Med Biol
Iron dysregulation and ferroptosis are associated with pulmonary fibrosis: Insight from idiopathic pulmonary fibrosis, systemic sclerosis, and COVID-19 patients. [Abstract]2025 Oct:91:127728. PMID: 40857901 -
Mol Immunol
Platycoside E alleviates allergic airway inflammation in obesity-related asthma mouse model. [Abstract]2023 Oct:162:74-83. PMID: 37659168
IL-13 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: Mol Immunol. 2023 Oct:162:74-83. [Abstract]
IL-13, Human (HEK293, His) (2-50 ng/mL; 24 -72 h). IL-13 treatment induces inflammatory damagein bronchial epithelial cells.(A) The BEAS-2B cells were treated with IL-13 at different concentrations (2, 10 and 50 ng/ml) for 24 h, 48 h and 72 h. The effect of IL-13 on cell viability was detected by CCK-8 assays.
-
BMC Pulm Med
β-elemene inhibits tumor-promoting in small cell lung cancer by affecting M2 macrophages and TGF-β. [Abstract]2025 Feb 28;25(1):97. PMID: 40022030
IL-13 Protein, Human (HEK293, His) purchased from MedChemExpress. Usage Cited in: BMC Pulm Med. 2025 Feb 28;25(1):97. [Abstract]
IL-13, Human (HEK293, His) (5 ng/mL; 48 h). IL-4 and IL-13 induce the differentiation of M0 macrophages into M2 macrophages.
-
Biochim Biophys Acta Gen Subj
2026 Jan;1870(1):130881. PMID: 41197918 -
PLoS One
JMJD3 regulates the M2-like macrophage polarization and promotes the growth of breast cancer cells via STAT6/IRF4 axis. [Abstract]2026 Apr 9;21(4):e0341313. PMID: 41955245 -
Hum Cell
METTL14 knockdown augmented the polarization of M2-like macrophages to promote acute myeloid leukemia progression. [Abstract]2025 Sep 30;38(6):168. PMID: 41026373 -
Biochem Biophys Res Commun
TPI1 promotes tumor progression and M2 macrophage polarization: Integrated pan-cancer and lung adenocarcinoma insights. [Abstract]2026 Jan 25:797:153099. PMID: 41447883 -
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P35225/AAH96139 (G35-N146)
-
Molecular Construction
-
N-term
-
IL-13 (G35-N146)
Accession # P35225/AAH96139 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
IL13; MGC116789; Interleukin 13; ALRH; IL-13; BHR1; Interleukin-13; Bronchial Hyperresponsiveness-1 (Bronchial Asthma); P600; Allergic Rhinitis; MGC116786; NC30; MGC116788
-
AA Sequence
GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN
-
Molecular Weight
Approximately 13-38 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)