1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-13
  5. IL-13 Protein, Human

IL-13 is a multifunctional cytokine. IL-13 activates the JAK-STAT6 signaling pathway and regulates gene expression by binding to the type II IL-4 receptor complex (IL-4Rα/IL-13Rα1) on the cell surface. IL-13 can induce monocyte CD23 expression, B cell IgE synthesis, fibroblast eotaxin secretion, and enhanced calcium flux in airway smooth muscle cells. IL-13 promotes airway inflammation in mice. IL-13 Protein, Human is a recombinant IL-13 protein expressed by E. coli without a tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

    IL-13 Protein, Human purchased from MCE. Usage Cited in: MedComm-Oncology. 2024 Apr 24.

    Maintaining IL-13 (4 ng/mL) is crucial for maintaining memory homeostasis, and drug exposure can lead to a decrease in IL-13 levels, thereby increasing the number of cellular sclerosis cells (CSCs).

    IL-13 Protein, Human purchased from MCE. Usage Cited in: MedComm-Oncology. 2024 Apr 24.

    IL-13 and long-term potentiation (LTP) using semi-quantitative PCR analysis. IL-13-mediated LTP desensitizes drug effect and enhances stemness markers (CD95 and CD58) and memory marker (GRIN2B) (+(w1 h) indicates that cells were replaced with fresh media after 1 h of incubation with IL-13 (4 ng/mL) and +(1 h) indicates 3BPA addition post 1h treatment initiation with IL-13).

    IL-13 Protein, Human purchased from MCE. Usage Cited in: BMC Pulm Med. 2023 Nov 2;23(1):422.  [Abstract]

    BEAS-2B cells were first treated with 10 ng/mL human IL-13 for 24 hours, and then treated with different concentrations (5, 10, 20 µM) of Ang-(1–7) for 24 hours. The expression of ATG5 protein in BEAS-2B cells was detected by Western blotting.

    IL-13 Protein, Human purchased from MCE. Usage Cited in: BMC Pulm Med. 2023 Nov 2;23(1):422.  [Abstract]

    HBSMC cells were first treated with 10 ng/mL human IL-13 for 24 hours, and then treated with different concentrations (5, 10, 20 µM) of Ang-(1–7) for 24 hours. The expression of ATG5 protein in HBSMC cells was detected by Western blotting.

    IL-13 Protein, Human purchased from MCE. Usage Cited in: BMC Pulm Med. 2023 Nov 2;23(1):422.  [Abstract]

    HBSMC cells were transfected with either control siRNA or ATG5 siRNA and then treated with IL-13 (10 ng/mL) for 24 hours. Cells treated with IL-13 were then treated with 20 µM Ang-(1–7) for 24 hours, with PBS treatment serving as a control. Cell viability was assessed using the CCK-8 assay kit.
    • Biological Activity

    • Technical Parameters

    • Properties

    • Documentation

    • References

    Description

    IL-13 is a multifunctional cytokine. IL-13 activates the JAK-STAT6 signaling pathway and regulates gene expression by binding to the type II IL-4 receptor complex (IL-4Rα/IL-13Rα1) on the cell surface. IL-13 can induce monocyte CD23 expression, B cell IgE synthesis, fibroblast eotaxin secretion, and enhanced calcium flux in airway smooth muscle cells. IL-13 promotes airway inflammation in mice. IL-13 Protein, Human is a recombinant IL-13 protein expressed by E. coli without a tag.

    Background

    IL-13 belongs to the interleukin (IL) family[1]. IL-13 is a multifunctional cytokine[1][2][5]. IL-13 binds to the type II IL-4 receptor complex (IL-4Rα/IL-13Rα1) on the cell surface, activates the JAK-STAT6 signaling pathway, and regulates gene expression. Its effects are cell type specific (e.g., dependent on the γc chain in hematopoietic cells and dependent on IL-13Rα1 in non-hematopoietic cells)[1][5]. IL-13 can induce monocyte CD23 expression, B cell IgE synthesis, fibroblast eotaxin secretion, and enhanced calcium flux in airway smooth muscle cells. IL-13 can promote airway eosinophil infiltration, AHR, and liver fibrosis in mice[1][3][5]. IL-13 is expressed in a variety of tissues and cells, including immune cells (such as macrophages, monocytes, B cells) and structural cells (such as fibroblasts, airway smooth muscle cells) in the lung, liver, esophagus, etc[1][3][5]. IL-13, Human has approximately 60% homology with mouse IL-13 in amino acid sequence, but there are species differences in function (such as human IL-13 does not activate mouse IL-13 receptor)[5]. IL-13, Human is a non-glycosylated protein composed of 132 amino acids with a molecular weight of approximately 10 kDa[4].

    In Vitro

    IL-13 Protein, Human (0.8 nM) induces eotaxin-1 production in normal human lung fibroblasts (NHLF)[5].

    In Vivo

    IL-13 Protein, Human (2 μg) induces inflammation in the mouse air pouch model, resulting in infiltration of leukocytes and eosinophils[5].

    Biological Activity

    The cell proliferation assay using human TF-1 cells has an ED50 value of less than 5 ng/mL.

    • Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 1.195 ng/mL, corresponding to a specific activity is 8.37×105 U/mg.
    Species

    Human

    Source

    E. coli

    Tag

    Tag Free

    Accession

    P35225 (G35-N146, Q144R)

    Gene ID
    Molecular Construction
    N-term
    IL-13 (G35-N146, Q144R)
    Accession # P35225
    C-term
    Protein Length

    Partial

    Synonyms
    Interleukin-13; IL-13
    AA Sequence

    GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

    Predicted Molecular Mass
    12.3 kDa
    Molecular Weight

    Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

    Purity
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.2, 5% trehalose.
    2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.2, 8% trehalose.
    Please refer to the lot-specific COA for specific buffer information.

    Endotoxin Level

    <1 EU/μg; determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Documentation
    References

    IL-13 Protein, Human Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    IL-13 Protein, Human

     

    Requested Quantity *

    Applicant Name *

     

    Salutation

    Email Address *

     

    Phone Number *

    Department

     

    Organization Name *

    City

    State

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    IL-13 Protein, Human
    Cat. No.:
    HY-P72795
    Quantity:
    MCE Japan Authorized Agent: