IL-18 Protein, Mouse (His)

IL-18 protein is a pro-inflammatory cytokine that plays an important role in epithelial barrier repair and immune response regulation by polarizing T helper 1 (Th1) cells and natural killer (NK) cells. After binding to IL18R1 and IL18RAP receptors, IL-18 forms a signaling ternary complex, activates NF-κ-B, and induces inflammatory mediators. IL-18 Protein, Mouse (His) is the recombinant mouse-derived IL-18 protein, expressed by E. coli , with N-6*His labeled tag.

IL-18 Protein is a pro-inflammatory cytokine that plays a crucial role in epithelial barrier repair and the modulation of immune responses by polarizing T-helper 1 (Th1) cells and natural killer (NK) cells. Upon binding to its receptors IL18R1 and IL18RAP, IL-18 forms a signaling ternary complex that activates NF-kappa-B, leading to the synthesis of inflammatory mediators. It synergizes with IL-12/interleukin-12 to induce the synthesis of IFNG from Th1 cells and NK cells. IL-18 is also involved in transducing inflammation downstream of pyroptosis, where its mature form is specifically released into the extracellular space through the gasdermin-D (GSDMD) pore. At the plasma membrane, IL-18 forms a ternary complex with IL18R1 and IL18RAP, with IL18 first binding to IL18R1 to form a low affinity binary complex, which then interacts with IL18RAP to form a high affinity ternary complex that signals within the cell. Additionally, IL-18 interacts with the cargo receptor TMED10 to facilitate its translocation from the cytoplasm to the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) for secretion.

1.Measured by its ability to induce IFN-gamma secretion by KG-1 human acute myelogenous leukemia cells in the presence of TNF-alpha. The ED₅₀ for this effect is 0.9227 ng/mL in the presence of 15 ng/mL TNF-alpha, corresponding to a specific activity is 1.08×10⁶ U/mg.
2.Measured by its ability to induce mouse IFN-gamma secretion by activated mouse T cells. The ED₅₀ for this effect is 0.1301 ng/mL, corresponding to a specific activity is 7.686×10⁶ U/mg.

• 
  Measured by its ability to induce IFN-gamma secretion by KG‑1 human acute myelogenous leukemia cells in the presence of TNF-alpha. The ED₅₀ for this effect is 0.9227 ng/mL in the presence of 15 ng/mL TNF-alpha, corresponding to a specific activity is 1.08×10⁶ U/mg.

Mouse

E. coli

N-6*His

P70380 (N36-S192)

16173  [NCBI]

Full Length of Mature Protein

NFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 10% trehalose, 50 mM NaCl, 0.1 mM EDTA, 0.05% Tween 80, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 1 mMEDTA, 2 mMDTT, 5% Trehalose, pH 8.0.
3.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 200 mM NaCl, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/jjn-3-cell.html  [Content Brief]