Copeptin (human)
Based on 1 Customer Validation
Copeptin (human) is a peptide biochemical reagent corresponding to the 39 amino acid sequence at the C-terminus of human pre-provasopressin, which serves as a stable surrogate biomarker reflecting the secretion of arginine vasopressin (AVP). Copeptin (human) can be used in studies related to AVP secretion, fluid and osmotic homeostasis, stress responses, and cardiovascular biomarkers.
Para uso exclusivo en investigación. No vendemos a pacientes.
- Pureza : 98.39%
- No. CAS: 78362-34-2
- Fòrmula: C177H279N49O58
- Peso molecular:4021.40
-
Almacenamiento:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Actividad biológica
-
Chemical Information
- Pureza y Documentación
- Referencias
-
Help & FAQs
Actividad biológica
Descripciòn
In Vitro
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Ensayo clínico
| NCT Number | Sponsor | Condition | Start Date |
Phase
|
|---|---|---|---|---|
| NCT01329991 | 2011-05 | PHASE1 |
Chemical Information
-
No. CAS 78362-34-2
-
Appearance Solid
-
Peso molecular 4021.40
-
Fòrmula C177H279N49O58
-
Color White to off-white
-
Sequence
Ala-Ser-Asp-Arg-Ser-Asn-Ala-Thr-Gln-Leu-Asp-Gly-Pro-Ala-Gly-Ala-Leu-Leu-Leu-Arg-Leu-Val-Gln-Leu-Ala-Gly-Ala-Pro-Glu-Pro-Phe-Glu-Pro-Ala-Gln-Pro-Asp-Ala-Tyr
-
Sequence Shortening
ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY
-
Envío
Room temperature in continental US; may vary elsewhere.
-
Almacenamiento
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Pureza y Documentación
-
Ficha de datos (261 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Instrucciones de manejo (2659 KB)
Referencias
[1]. Mu D, et al. Copeptin as a Diagnostic and Prognostic Biomarker in Cardiovascular Diseases. Frontiers in cardiovascular medicine. 2022;9:901990. [Content Brief]
[2]. Makwana R, et al. Copeptin, a surrogate marker of arginine vasopressin, has no ability to modulate human and mouse gastric motility. European journal of pharmacology. 2021 Feb 05;892:173740. [Content Brief]
[3]. Morgenthaler NG, et al. Assay for the measurement of copeptin, a stable peptide derived from the precursor of vasopressin. Clinical chemistry. 2006 Jan;52(1):112-9. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Copeptin (human) Related Classifications
HY-P5007 Related Classifications
Powered by Bioz