KTX-Sp2
KTX-Sp2 is a potassium channel toxin. KTX-Sp2 effectively blocks three types of exogenous voltage-gated potassium channels: Kv1.1, Kv1.2 and Kv1.3. Ktx-Sp2 inhibits endogenous Kv1.3 and suppresses Ca2+ signaling in Jurkat T cells. Ktx-Sp2 inhibits IL-2 secretion from activated Jurkat T cells.
Para uso exclusivo en investigación. No vendemos a pacientes.
- Fòrmula: C155H244N58O49S7
- Peso molecular:3928.41
-
Almacenamiento:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Actividad biológica
-
Chemical Information
- Pureza y Documentación
- Referencias
-
Help & FAQs
Actividad biológica
Kv1.1, Kv1.2, Kv1.3[1]
Chemical Information
-
Peso molecular 3928.41
-
Fòrmula C155H244N58O49S7
-
Sequence
Ser-Pro-Leu-His-Gly-Ala-Lys-Cys-Ser-Ser-Ser-Asn-Gln-Cys-Thr-Arg-Pro-Cys-Arg-Tyr-Gly-Gly-Gly-Thr-His-Gly-Lys-Cys-Met-Asn-Gly-Arg-Cys-Arg-Cys-Tyr-Gly (Disulfide bridge: Cys8-Cys28,Cys14-Cys33,Cys18-Cys35)
-
Sequence Shortening
SPLHGAKCSSSNQCTRPCRYGGGTHGKCMNGRCRCYG (Disulfide bridge: Cys8-Cys28,Cys14-Cys33,Cys18-Cys35)
-
Envío
Room temperature in continental US; may vary elsewhere.
-
Almacenamiento
Please store the product under the recommended conditions in the Certificate of Analysis.
Pureza y Documentación
Referencias
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
KTX-Sp2 Related Classifications
HY-P5870 Related Classifications
Powered by Bioz