β-defesin 1 (pig)
β-defesin 1 (pig) (pBD-1) is an endogenous and constitutively expressed antimicrobial peptide (AMP) from porcine tissues, particularly expresses in pig mucosal epithelial sites. β-defesin 1 (pig) has antimicrobial activities and contributes to mucosal and systemic host defenses in pigs.
Para uso exclusivo en investigación. No vendemos a pacientes.
- Fòrmula: C180H313N59O50S9
- Peso molecular:4392.36
-
Almacenamiento:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Actividad biológica
-
Chemical Information
- Pureza y Documentación
- Referencias
-
Help & FAQs
Actividad biológica
IC50: bacterial[1]
In a northern blot analysis, β-defesin 1 (pig) mRNA only expresses in ongue epithelial tissues from 4-5 week old pigs[1].In RT-PCR analysis, β-defesin 1 (pig) message throughout the epithelia of the respiratory (from nasal septum to lung) and gastrointestinal (from esophagus to rectum) tracts. In addition, it is detected in thymus, spleen, lymph node, brain, liver, kidney, urinary bladder, testis, skin, heart, muscle, bone marrow, alveolar macrophages, peripheral blood neutrophils and the umbilical cord. The only cells evaluated that does not express β-defesin 1 (pig) are peripheral blood mononuclear cells[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Peso molecular 4392.36
-
Fòrmula C180H313N59O50S9
-
Synonyms
pBD-1
-
Sequence
Asn-Ile-Gly-Asn-Ser-Val-Ser-Cys-Leu-Arg-Asn-Lys-Gly-Val-Cys-Met-Pro-Gly-Lys-Cys-Ala-Pro-Lys-Met-Lys-Gln-Ile-Gly-Thr-Cys-Gly-Met-Pro-Gln-Val-Lys-Cys-Cys-Lys-Arg-Lys (disulfide bridge:Cys1-Cys5,Cys2-Cys4,Cys3-Cys6）
-
Sequence Shortening
NIGNSVSCLRNKGVCMPGKCAPKMKQIGTCGMPQVKCCKRK (disulfide bridge:Cys1-Cys5,Cys2-Cys4,Cys3-Cys6）
-
Envío
Room temperature in continental US; may vary elsewhere.
-
Almacenamiento
Please store the product under the recommended conditions in the Certificate of Analysis.
Pureza y Documentación
Referencias
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
β-defesin 1 (pig) Related Classifications
HY-P2289 Related Classifications
Powered by Bioz