Peptide A5K
Based on 1 Customer Validation
Peptide A5K (INF7-A5K-TAT) is an amphiphilic peptide derived from the HA2-TAT fusion scaffold. Peptide A5K can non-covalently bind to CRISPR ribonucleoproteins and efficiently deliver them to cells, such as primary human T cells, B cells, and NK cells. Peptide A5K enables low-toxicity, precise, and multiplex genome editing, holding great application potential in the field of cell therapy.
For research use only. We do not sell to patients.
- Purity: 99.34%
- Formula: C182H275N55O48S
- Molecular Weight:4033.54
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
Peptide A5K effectively edits T cells without substantial impact on T cell viability[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Appearance Solid
-
Molecular Weight 4033.54
-
Formula C182H275N55O48S
-
Color White to off-white
-
Synonyms
INF7-A5K-TAT
-
Sequence
Gly-Leu-Phe-Glu-Lys-Ile-Glu-Gly-Phe-Ile-Glu-Asn-Gly-Trp-Glu-Gly-Met-Ile-Asp-Gly-Trp-Tyr-Gly-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg
-
Sequence Shortening
GLFEKIEGFIENGWEGMIDGWYGYGRKKRRQRR
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
H2O : ≥ 100 mg/mL (24.79 mM)
* "≥" means soluble, but saturation unknown.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (280 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O | 1 mM | 0.2479 mL | 1.2396 mL | 2.4792 mL | 6.1980 mL |
| 5 mM | 0.0496 mL | 0.2479 mL | 0.4958 mL | 1.2396 mL | |
| 10 mM | 0.0248 mL | 0.1240 mL | 0.2479 mL | 0.6198 mL | |
| 15 mM | 0.0165 mL | 0.0826 mL | 0.1653 mL | 0.4132 mL | |
| 20 mM | 0.0124 mL | 0.0620 mL | 0.1240 mL | 0.3099 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Peptide A5K Related Classifications
HY-P5307 Related Classifications
Powered by Bioz