Klotho-derived peptide 1 hydrochloride
Based on 1 Customer Validation
Klotho-derived peptide 1 hydrochloride (KP1 (human) hydrochloride) is a polypeptide with multiple activities including senescence inhibition and renal protection. Klotho-derived peptide 1 hydrochloride binds to TβR2 and ATAD3A, with a Kd value of 1.41 μM for binding to human TβR2 and a Kd value of 0.319 μM for binding to ATAD3A. By binding to TβR2, Klotho-derived peptide 1 hydrochloride blocks the TGF-β/Smad3 and downstream TGF-β signaling pathways, inhibits the expression of miR-223-3p, induces the expression of lncRNA-TUG1, restores endogenous Klotho at the post-transcriptional level, inhibits cellular senescence markers, fibroblast activation and renal tubular epithelial cell apoptosis, blocks cytochrome c release and caspase activation, maintains the integrity of mitochondrial ultrastructure, and restores mitochondrial protein levels. Klotho-derived peptide 1 hydrochloride enters renal tubular epithelial cells via endocytosis, protects against nephrotoxic and hypoxic injuries, and recapitulates the renal protective and anti-fibrotic effects of full-length Klotho. Klotho-derived peptide 1 hydrochloride can be used in research related to kidney diseases such as chronic kidney disease and SARS-CoV-2-associated acute kidney injury.
For research use only. We do not sell to patients.
- Purity : 99.67%
- Formula: C149H203N39O43.xHCl
- Molecular Weight:3228.44 (free base)
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Biological Activity
Description
IC50 & Target
|
TGF-βR2 1.41 μM (Kd) |
In Vitro
Klotho-derived peptide 1 (KP1) hydrochloride inhibits TGF-β1-induced cellular senescence in HK-2 cells via post-transcriptional regulation, and restores the expression of mKlotho and sKlotho proteins; it suppresses miR-223-3p, restores the expression of mKlotho, sKlotho and lncRNA-TUG1, and inhibits miR-223-3p-induced cellular senescence and the expression of fibrosis markers in HK-2 cells[1].
Klotho-derived peptide 1 hydrochloride inhibits the TGF-β/Smad3/miR-223-3p axis, restores the protein expression of mKlotho and sKlotho, and antagonizes TGF-β1-induced cellular senescence and fibrosis in HK-2 cells[1].
Klotho-derived peptide 1 hydrochloride binds tightly to recombinant human transforming growth factor-β receptor 2, with an equilibrium dissociation constant (KD) of 1.41 μM[3].
Klotho-derived peptide 1 hydrochloride specifically binds to recombinant human transforming growth factor β receptor 2; it also binds to endogenous TGF-β receptor 2 in lysates of normal rat renal interstitial fibroblasts (NRK-49F)[3].
Klotho-derived peptide 1 hydrochloride inhibits TGF-β1-induced myofibroblast activation, extracellular matrix protein expression, and both canonical and non-canonical TGF-β signaling pathways; it suppresses TGF-β1-induced extracellular matrix protein expression and Smad2/3 phosphorylation; it blocks the binding of TGF-β1 to TGF-β receptor 2, the formation of TGF-β receptor 1/TGF-β receptor 2 heterodimers, and the interaction between soluble Klotho and TGF-β receptor 2[3].
Klotho-derived peptide 1 hydrochloride binds to ATAD3A with high affinity (Kd = 3.19×10-7 M) in cell-free MST binding assays using lysates transfected with GFP-ATAD3A; it stabilizes ATAD3A in a dose-dependent manner in cell-free DARTS assays using lysates with overexpressed ATAD3A[4].
Klotho-derived peptide 1 (3 μM; 1 h) hydrochloride restores the Cisplatin-reduced levels of ATAD3A and HIGD2A proteins in HKC-8 renal tubular epithelial cells, and inhibits the release of cytochrome c from mitochondria[4].
Klotho-derived peptide 1 (10 μg/mL; 48 h) hydrochloride protects human renal proximal tubular HK-2 cells from injury and apoptosis induced by SARS-CoV-2 N protein, eliminates the upregulation of injury and apoptosis markers, and reduces the proportion of apoptotic cells[2].
Klotho-derived peptide 1 (3 μM; 1 h) hydrochloride protects primary mouse proximal tubular epithelial cells against Cisplatin (HY-17394)- and H/R-induced injury, apoptosis, and mitochondrial dysfunction[4].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. Further protocols information, click here.
-
Cell Line:human kidney proximal tubular cells (HK-2)
-
Concentration:10 μg/mL
-
Incubation Time:48 h
-
Result:Abolished the SARS-CoV-2 N protein-induced upregulation of kidney injury molecule-1 (KIM-1), cleaved poly-ADP-ribose polymerase (PARP), p53, and FAS-associated protein with death domain (FADD).
Negated the increase in TUNEL-positive apoptotic cells induced by N protein, with efficacy comparable to recombinant human Klotho.
-
Cell Line:HKC-8 human renal tubular epithelial cells (Cisplatin-induced injury model and hypoxia/reoxygenation [H/R]-induced injury model)
-
Concentration:3 μM (KP1); 7 μg/mL (Cisplatin)
-
Incubation Time:1 h (KP1 pre-incubation); 24 h (cisplatin incubation)
1 h (KP1 pre-incubation); 24 h (hypoxia); 4-6 h (reoxygenation) -
Result:Completely restored cisplatin-depleted ATAD3A protein levels in HKC-8 cells.\nRestored cisplatin-depleted HIGD2A protein levels and reversed cytochrome c translocation from mitochondria to cytosol in HKC-8 cells.
Completely restored H/R-depleted ATAD3A protein levels in HKC-8 cells. Restored H/R-depleted HIGD2A protein levels and reversed cytochrome c translocation from mitochondria to cytosol in HKC-8 cells.
In Vivo
Klotho-derived peptide 1 (1 mg/kg/day; i.v.; daily; 7 days starting day 4 post-surgery) hydrochloride inhibits cellular senescence, restores Klotho protein expression, improves kidney function, and suppresses fibrosis in UIRI-induced chronic kidney disease by inhibiting miR-223-3p[1].
Klotho-derived peptide 1 (1 mg/kg/day; i.v.; daily starting day 1 post-surgery) hydrochloride mitigates shTUG1-induced kidney injury in UUO-induced chronic kidney disease by restoring lncRNA-TUG1 and Klotho protein expression, and inhibiting miR-223-3p[1].
Klotho-derived peptide 1 (1 mg/kg/day; i.v.; daily starting day 4 post-surgery) hydrochloride reverses miR-223-3p-induced Klotho reduction, cellular senescence, fibrosis, and kidney dysfunction in UIRI-induced chronic kidney disease[1].
Klotho-derived peptide 1 (1 mg/kg; i.v.; daily; 4 days) hydrochloride ameliorates acute kidney injury induced by SARS-CoV-2 N protein and ischemia-reperfusion injury in male C57BL/6 mice, as evidenced by reduced serum creatinine and blood urea nitrogen levels, restored Klotho expression, inhibited injury marker induction, and suppressed tubular apoptosis[2].
Klotho-derived peptide 1 (1 mg/kg; i.v.; daily; 7 consecutive days) hydrochloride preserves kidney function, reduces renal fibrosis by ~60%, inhibits TGF-β signaling, and restores endogenous Klotho expression in male BALB/c mice with unilateral ischemia-reperfusion injury[3].
Klotho-derived peptide 1 (1 mg/kg; i.v.; daily; 6 consecutive days) hydrochloride reduces renal fibrosis by ~50%, inhibits TGF-β signaling and renal inflammation, and restores endogenous Klotho expression in male BALB/c mice with unilateral ureter obstruction[3].
Klotho-derived peptide 1 (KP1) (5 mg/kg; daily; 2 days pre-cisplatin) hydrochloride protects against cisplatin-induced acute kidney injury in male C57BL/6 mice by reducing renal dysfunction, injury marker expression, tubular apoptosis, and restoring mitochondrial protein levels[4].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:C57BL/6 (male, 8-10 weeks old, unilateral ureteral obstruction model)[1]
-
Dosage:1 mg/kg/day
-
Administration:i.v.; daily; 6 days starting day 1 post-surgery
-
Result:Abolished the induction of cellular senescence markers p21, p16, and γ-H2AX in kidney tissue.
Restored renal expression of membranous Klotho (mKlotho) and soluble Klotho (sKlotho) proteins, but did not affect Klotho mRNA levels.
Inhibited upregulation of fibrotic markers fibronectin, collagen I, and α-SMA in kidney tissue.
-
Animal Model:C57BL/6 (male, 8-10 weeks old, unilateral ischemia-reperfusion injury model)[1]
-
Dosage:1 mg/kg/day
-
Administration:i.v.; daily; 7 days starting day 4 post-surgery
-
Result:Eliminated tubular cellular senescence markers including p21, p16 and γ-H2AX as well as SA-β-Gal, recovered mKlotho and sKlotho protein abundance without altering Klotho transcription, lowered fibronectin, collagen I and α-SMA fibrotic markers, relieved renal dysfunction via declined serum creatinine and BUN, and inhibited UIRI-triggered renal miR-223-3p overexpression.
-
Animal Model:C57BL/6 (male, 8-10 weeks old, unilateral ureteral obstruction model)[1]
-
Dosage:1 mg/kg/day (Klotho-derived peptide 1); 2.5 mg/kg (shTUG1 plasmid)
-
Administration:i.v.; daily starting day 1 post-surgery (Klotho-derived peptide 1); i.v.; single dose day 1 post-surgery (shTUG1 plasmid)
-
Result:Recovered shTUG1-suppressed renal lncRNA-TUG1 expression, restrained shTUG1-evoked renal miR-223-3p elevation, restored shTUG1-depleted mKlotho and sKlotho protein without changing Klotho mRNA, erased shTUG1-induced p21, p16 and γ-H2AX senescence markers, and suppressed shTUG1-triggered overexpression of fibronectin, collagen I and α-SMA fibrotic proteins.
-
Animal Model:C57BL/6 (male, 8-10 weeks old, unilateral ischemia-reperfusion injury model)[1]
-
Dosage:1 mg/kg/day (Klotho-derived peptide 1); 2.5 mg/kg (miR-223-3p overexpression plasmid)
-
Administration:i.v.; daily starting day 4 post-surgery (Klotho-derived peptide 1); i.v.; single dose day 4 post-surgery (miR-223-3p overexpression plasmid)
-
Result:Reduced the elevated renal miR-223-3p levels induced by the overexpression plasmid.
Restored mKlotho and sKlotho protein expression that was suppressed by miR-223-3p overexpression, without affecting Klotho mRNA levels.
Abolished the exacerbated induction of cellular senescence markers p16 and γ-H2AX caused by miR-223-3p overexpression.
Inhibited the increased expression of fibrotic markers fibronectin, collagen I, and α-SMA triggered by miR-223-3p overexpression.
Improved kidney function as measured by decreased serum creatinine and blood urea nitrogen levels.
-
Animal Model:BALB/c (male, 20-22 g, unilateral ischemia-reperfusion injury)[3]
-
Dosage:1 mg/kg
-
Administration:i.v.; daily; 7 consecutive days
-
Result:Selectively enriched in damaged kidney tissue with negligible deposition in healthy kidney and other visceral organs, and alleviated renal dysfunction by lowering serum creatinine and BUN concentrations.
Markedly shrank renal fibrotic lesions and diminished fibronectin/α-SMA positive interstitial regions, while decreasing profibrotic protein fibronectin, α-SMA and collagen expression in kidney tissues.
Interrupted TGF-β1/TβR2 signaling cascade via downregulating phosphorylated Smad, MAPK and TβR2 proteins, and rescued renal endogenous Klotho protein abundance.
-
Animal Model:BALB/c (male, 20-22 g, unilateral ureter obstruction)[3]
-
Dosage:1 mg/kg
-
Administration:i.v.; daily; 6 consecutive days
-
Result:Accumulated selectively in obstructed renal tissue (~12 ng/mg) with far lower distribution in normal kidney and visceral organs, and localized mainly to renal tubular epithelial cells. It cut renal fibrotic region and vimentin-positive cell numbers by roughly half.
Downregulated fibronectin, α-SMA and collagen I renal protein abundance by about 65%, 80% and 80%, disrupted TGF-β cascade by lowering phosphorylated Smad2/3, ERK/JNK/p38 and TβR2 protein levels.
Eliminated renal F4/80 macrophage marker, suppressed immune cell infiltration, and recovered renal Klotho protein expression and positive staining area to prominent levels.
Chemical Information
-
Appearance Solid
-
Molecular Weight 3228.44 (free base)
-
Formula C149H203N39O43.xHCl
-
Color White to off-white
-
Synonyms
KP1 (human) hydrochloride
-
Sequence
Phe-Gln-Gly-Thr-Phe-Pro-Asp-Gly-Phe-Leu-Trp-Ala-Val-Gly-Ser-Ala-Ala-Tyr-Gln-Thr-Glu-Gly-Gly-Trp-Gln-Gln-His-Gly-Lys-Gly
-
Sequence Shortening
FQGTFPDGFLWAVGSAAYQTEGGWQQHGKG
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
In Vitro:
H2O : 50 mg/mL (Need ultrasonic)
0.1 M Acetic acid : 50 mg/mL (adjust pH to 2 with CH3COOH)
Protocols
-
RNA extraction experimental
By lysing cells, releasing RNA, and removing impurities such as proteins and DNA, high-purity RNA products are finally obtained. The commonly used traditional method is the guanidine isothiocyanate/phenol/chloroform method (Trizol), which is suitable for a variety of animal materials including animal tissues, microorganisms, cultured cells, etc., and most plant materials.
-
Apoptosis
Apoptosis, also called programmed cell death, is generally characterized by distinct morphological characteristics.
-
TUNEL staining for apoptotic DNA fragmentation
TUNEL staining detects DNA strand breaks by using terminal deoxynucleotidyl transferase to add labeled nucleotides to exposed 3′-OH DNA termini, generating either microscopic staining in fixed cells or tissue sections, or fluorescence/cytometric signal in cell suspensions. TUNEL positivity reflects DNA fragmentation but should not be interpreted alone as definitive apoptosis, because TUNEL can also label necrotic, autolytic, mechanically damaged, or DNA-repair-associated DNA breaks.
-
Nephrotoxicity Study
This protocol assesses nephrotoxicity by combining functional kidney injury readouts, urinary/tissue injury biomarkers, and renal histopathology. Serum creatinine and BUN reflect impaired kidney function, while KIM-1, NGAL, clusterin, osteopontin, IL-18, cystatin C, nephrin, Oat5, urinary protein, glucose, and alkaline phosphatase have been used to detect tubular injury in cisplatin-, gentamicin-, and acetaminophen-induced nephrotoxicity models.
-
Annexin V plus membrane-impermeant dye apoptosis staining
Annexin V-based apoptosis assays rely on the detection of phosphatidylserine (PS) externalization from the inner leaflet of the plasma membrane to the outer leaflet, an early biochemical hallmark of apoptosis. Fluorescently labeled Annexin V binds PS in a calcium-dependent manner, enabling identification of early apoptotic cells by flow cytometry or fluorescence microscopy. When combined with a membrane-impermeant DNA-binding dye (e. g. , propidium iodide), this approach allows discrimination between viable (Annexin V−/dye−), early apoptotic (Annexin V+/dye−), and late apoptotic or necrotic (Annexin V+/dye+) cell populations by assessing membrane integrity and PS exposure.
-
Apoptosis Solutions
Apoptosis is a regulated, generally non-lytic cell-death pathway that removes unwanted, damaged, infected, or abnormal cells through coordinated morphological changes, caspase activation, DNA fragmentation, and membrane remodeling. The intrinsic apoptosis pathway is controlled mainly by mitochondrial outer membrane permeabilization, BCL-2 family proteins, cytochrome c release, apoptosome formation, caspase-9 activation, and downstream executioner caspase-3/7 activation. The extrinsic apoptosis pathway is initiated by death receptors such as Fas, TNFR, and TRAIL receptors, which recruit adaptor proteins and activate caspase-8 before engaging executioner caspases or mitochondrial amplification through BID cleavage. Apoptosis is linked to many phenotypes, including cancer cell killing, tissue homeostasis, immune regulation, neurodegeneration, infection response, and treatment-induced cytotoxicity; unresolved questions include how apoptosis interacts with necroptosis, pyroptosis, ferroptos
-
Senescence-associated β-galactosidase staining
Senescence-associated β-galactosidase staining detects β-galactosidase activity that is histochemically visible at pH 6. 0 in senescent cells, where X-gal cleavage produces an insoluble blue precipitate observable by bright-field microscopy. This activity reflects increased lysosomal β-galactosidase/lysosomal mass rather than a senescence-essential enzyme, because GLB1 depletion or genetic lysosomal β-galactosidase deficiency can abolish SA-β-gal staining while cells still undergo senescence. SA-β-gal was originally reported in senescent but not presenescent fibroblasts and keratinocytes, absent from quiescent fibroblasts and terminally differentiated keratinocytes, and increased with donor age in human skin samples. Because SA-β-gal can also appear in some non-senescent or tissue-specific contexts, interpretation should be paired with experimental controls and, when possible, independent senescence markers.
Purity & Documentation
-
Data Sheet (298 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
References
[1]. Zhang X, et al. Klotho-derived peptide 1 inhibits cellular senescence in the fibrotic kidney by restoring Klotho expression via posttranscriptional regulation. Theranostics. 2024;14(1):420-435. [Content Brief]
[2]. Xu J, et al. Klotho-derived peptide KP1 ameliorates SARS-CoV-2-associated acute kidney injury. Frontiers in pharmacology. 2023;14:1333389. [Content Brief]
[3]. Yuan Q, et al. A Klotho-derived peptide protects against kidney fibrosis by targeting TGF-β signaling. Nature communications. 2022 Jan 21;13(1):438. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)