country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Country or Region:

United States

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P10487

Copy Link Print Information

APP669-711

APP669-711 is an N-terminally extended amyloid β peptide (Aβ (-3)-40) that forms amyloid fibrils and co-deposits with Aβ in brain plaques, and also serves as a plasma biomarker for assessing brain Aβ load. APP669-711 can be used in research on Alzheimer's disease.

For research use only. We do not sell to patients.

Formula: C₂₁₀H₃₂₅N₅₇O₆₁S₂
Molecular Weight:4688.30

Storage:

Please store the product under the recommended conditions in the Certificate of Analysis.

APP669-711 Chemical Structure

Price

Stock

Quantity

Amount: USD 0.00

* Please select Quantity before adding items.

Use of MCE Products

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity
- Description
- In Vitro
Chemical Information
Purity & Documentation
References
Calculators
Help & FAQs
Classifications
Bioz

Biological Activity

Description

In Vitro

APP669-711 is produced in HEK293A cells by APPwt and c102 in a DAPT-sensitive manner, is upregulated by ADAMTS4, and is abolished by the Swedish mutation^[1].
APP669-711 production in HEK293A cells is enhanced to a greater extent by ADAMTS5 co-expression than by ADAMTS4, requires the ADAMTS5 Sp domain, and is abolished by the E411A catalytic mutation or an ADAMTS5 inhibitor; exogenous ADAMTS5 conditioned medium does not significantly increase APP669-711^[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Related Protocols :

Chemical Information

Molecular Weight 4688.30
Formula C₂₁₀H₃₂₅N₅₇O₆₁S₂
Sequence

Val-Lys-Met-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val
Sequence Shortening

VKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (300 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. Matsuzaki M, et al. ADAMTS4 is involved in the production of the Alzheimer disease amyloid biomarker APP669-711. Molecular psychiatry. 2023 Apr;28(4):1802-1812.

[2]. Kaneko N, et al. Novel plasma biomarker surrogating cerebral amyloid deposition. Proceedings of the Japan Academy. Series B, Physical and biological sciences. 2014;90(9):353-64.

[3]. Yokoyama M, et al. Identification of ADAMTS5 as APP-Cleaving Enzyme at the APP669 Site. FASEB journal : official publication of the Federation of American Societies for Experimental Biology. 2026 Apr 15;40(7):e71701.

Calculators

Molarity Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Dilution Calculator

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Bioz

Keywords

MOQ

Minimum order quantity

100 mg

Get Quote In-stock

Other size

Get Quote