SNX-482
Based on 1 publication(s) in Google Scholar
SNX-482, a peptide, is a potent, high affinity, selective and voltage-dependent R-type CaV2.3 channel blocker with an IC50 of 30 nM. SNX-482 has antinociceptive effect.
연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.
- Purity : 98%
- CAS No.: 203460-30-4
- 화학식: C192H274N52O60S7
- 분자량:4495.00
-
보관:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
용액&용해도
- 순도&문서
- References
-
Help & FAQs
-
HY-B0233
IsradipineL-type Calcium Channel Blocker -
HY-A0064
Verapamil hydrochlorideCalcium Channel Blocker -
HY-P1080
ω-Agatoxin IVAP/Q Type Ca2+ Channel Blocker -
HY-P1075
CALP3Ca2+ Channel Blocker -
HY-P1080A
ω-Agatoxin IVA TFACav2.1 Channel Blocker -
HY-P1073
ProTx-INaV/Cav Inhibitor -
HY-P1079
ω-Agatoxin TKP/Q Type Ca2+ Channel Blocker -
HY-P1077
CALP1Calmodulin Agonist -
HY-P0062B
Ziconotide acetateN-type Calcium Channels Antagonist -
HY-10035
TTA-P2T-type Calcium Channel Blocker -
HY-14650
DHEASteroid Hormone -
HY-13434
IonomycinCalcium Ionophore
Publications Citing Use of MedChemExpress (MCE) SNX-482
MoreAll Calcium Channel Isoforms
More
Biological Activity
제품 설명
IC50 & Target
IC50: 30 nM (CaV2.3 channel)[2]
In Vitro
SNX-482 blocks the class E Ca2+ channel with an IC50 of 15-30 nM, using either patch clamp electrophysiology or K+-evoked Ca2+ flux[1].
At low nanomolar concentrations, SNX-482 also blocks a native resistant or R-type Ca2+ current in rat neurohypophyseal nerve terminals, but concentrations of 200-500 nM have no effect on R-type Ca2+ currents in several types of rat central neurons[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. .
In Vivo
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Male Sprague-Dawley rats (initially weighing 130-150 g) + Spinal nerve ligation[3]
-
Dosage:0.5 μg/50 μL, 1.5 μg/50 μL, 4 μg/50 μL
-
Administration:Applied directly onto the spinal cord, 14-17 days post-operation
-
Result:Exerted a significant dose-related inhibitory effect on C-fiber evoked responses, Aδ-fiber responses, post-discharge and input measurements.
Inhibited the "wind-up" of neurons.
Chemical Information
-
CAS No. 203460-30-4
-
Appearance Solid
-
분자량 4495.00
-
화학식 C192H274N52O60S7
-
Color White to off-white
-
Sequence
Gly-Val-Asp-Lys-Ala-Gly-Cys-Arg-Tyr-Met-Phe-Gly-Gly-Cys-Ser-Val-Asn-Asp-Asp-Cys-Cys-Pro-Arg-Leu-Gly-Cys-His-Ser-Leu-Phe-Ser-Tyr-Cys-Ala-Trp-Asp-Leu-Thr-Phe-Ser-Asp (Disulfide bridge:Cys7-Cys21;Cys14-Cys26;Cys20-Cys33)
-
Sequence Shortening
GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD (Disulfide bridge:Cys7-Cys21;Cys14-Cys26;Cys20-Cys33)
-
선적
Room temperature in continental US; may vary elsewhere.
-
보관
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Mol Pain
Characterization of excitatory synaptic transmission in the retrosplenial cortex of adult mice. [Abstract]2025 Jan-Dec:21:17448069251335500. PMID: 40317242
용액&용해도
In Vitro:
H2O : 0.5 mg/mL (0.11 mM; Need ultrasonic and warming)
순도&문서
-
Data Sheet (300 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. R Newcomb, et al. Selective peptide antagonist of the class E calcium channel from the venom of the tarantula Hysterocrates gigas. Biochemistry. 1998 Nov 3;37(44):15353-62. [Content Brief]
[2]. E Bourinet, et al. Interaction of SNX482 with domains III and IV inhibits activation gating of alpha(1E) (Ca(V)2.3) calcium channels. Biophys J. 2001 Jul;81(1):79-88. [Content Brief]
[3]. Elizabeth A Matthews, et al. The Cav2.3 calcium channel antagonist SNX-482 reduces dorsal horn neuronal responses in a rat model of chronic neuropathic pain. Eur J Neurosci. 2007 Jun;25(12):3561-9. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
SNX-482 Related Classifications
HY-P1074 Related Classifications
Powered by Bioz