Ularitide
Ularitide (Urodilatin), natriuretic peptide, is a vasodilator. Ularitide binds to and activates renal receptors. Ularitide also regulates renal dopamine metabolism Ularitide can be used in the research of heart failure.
연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.
- CAS No.: 118812-69-4
- 화학식: C145H234N52O44S3
- 분자량:3505.96
-
보관:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- 순도&문서
- References
-
Help & FAQs
Biological Activity
Ularitide increases the amount of cyclic nucleotides and decreases the raise in permeability in HUVEC cells[2]. Ularitide (1 nM-1 μM, 15 min) reverses methacholine-evoked contraction in bovine bronchi[3]. Ularitide (1 μM, 0-300 s) increases cyclic GMP levels in the presence of phosphoramidon in bovine bronchi[3].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Female dogs with or without surgically induced chronic aortocaval fistula[1]
-
Dosage:5 and 10 pmol/kg/min
-
Administration:i.v. infusions for for 75 min, and thereafter at 10 pmol/kg/min for another 75 min.
-
Result:Increased in urine volume and sodium excretion with high-output CHF.
| NCT Number | Sponsor | Condition | Start Date |
Phase
|
|---|---|---|---|---|
| NCT01329991 | Plexxikon| | 2011-05 | PHASE1 |
Chemical Information
-
CAS No. 118812-69-4
-
분자량 3505.96
-
화학식 C145H234N52O44S3
-
Synonyms
Urodilatin (human)
-
Sequence
Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge:Cys11-Cys27)
-
Sequence Shortening
TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge:Cys11-Cys27)
-
선적
Room temperature in continental US; may vary elsewhere.
-
보관
Please store the product under the recommended conditions in the Certificate of Analysis.
순도&문서
References
[2]. Korn C, et al. Comparison of the effects of ularitide acetate and other bronchorelaxing substances on the thrombin-induced permeability raise of human endothelial cell monolayers. Arzneimittelforschung. 1998 Mar;48(3):251-8. [Content Brief]
[3]. Nally JE, et al. Bronchodilator and pre-protective effects of urodilatin in bovine bronchi in vitro: comparison with atrial natriuretic peptide. Br J Pharmacol. 1995 Apr;114(7):1391-6. [Content Brief]
[4]. Valentin JP, et al. Urodilatin binds to and activates renal receptors for atrial natriuretic peptide. Hypertension. 1993 Apr;21(4):432-8. [Content Brief]
[5]. Choi MR, et al. Urodilatin regulates renal dopamine metabolism. J Nephrol. 2013 Nov-Dec;26(6):1042-8. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Ularitide Related Classifications
HY-P2687 Related Classifications
Powered by Bioz