country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Country or Region:

United States

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Referencia número: HY-P11139

Copy Link Print Information

Lactocin 705β

Name: Lactocin 705β
Brand: MedChemExpress
SKU: HY-P11139
Availability: PreOrder

(Synonyms: Lac705β)

Lactocin 705β (Lac705β) is a peptide segment that can form class IIb bacteriocins Lactocin 705 with Lac705α (HY-P11138) . Lactocin 705β has no antibacterial activity when used alone. Lactocin 705β can be used for research on bacterial infections.

Para uso exclusivo en investigación. No vendemos a pacientes.

No. CAS: 929219-92-1
Fòrmula: C₁₄₇H₂₁₁N₄₇O₄₂
Peso molecular:3308.54

Almacenamiento:

Please store the product under the recommended conditions in the Certificate of Analysis.

Lactocin 705β Chemical Structure

No. CAS: 929219-92-1

Tamaño

Precio

Stock

Cantidad

Amount: USD 0.00

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Actividad biológica

Descripciòn

Chemical Information

No. CAS 929219-92-1
Peso molecular 3308.54
Fòrmula C₁₄₇H₂₁₁N₄₇O₄₂
Synonyms

Lac705β
Sequence

Gly-Phe-Trp-Gly-Gly-Leu-Gly-Tyr-Ile-Ala-Gly-Arg-Val-Gly-Ala-Ala-Tyr-Gly-His-Ala-Gln-Ala-Ser-Ala-Asn-Asn-His-His-Ser-Pro-Ile-Asn-Gly
Sequence Shortening

GFWGGLGYIAGRVGAAYGHAQASANNHHSPING
Envío

Room temperature in continental US; may vary elsewhere.
Almacenamiento

Please store the product under the recommended conditions in the Certificate of Analysis.

Pureza y Documentación

Select Batch:

Pureza: 99.98%

Assay: 99.98%

ee.: 99.98%

Ficha de datos (258 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Instrucciones de manejo (2659 KB)

Referencias

[1]. Castellano P, et al. Molecular view by fourier transform infrared spectroscopy of the relationship between lactocin 705 and membranes: speculations on antimicrobial mechanism. Appl Environ Microbiol. 2007 Jan;73(2):415-20.

Calculators

Calculadora de molaridad

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Calculadora de dilución

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Bioz

Keywords

MOQ

Minimum order quantity

100 mg

Obtener un presupuesto En stock

Other size

Obtener un presupuesto