country

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P11139

Copy Link Print Information

Lactocin 705β

(Synonyms: Lac705β)

Lactocin 705β (Lac705β) is a peptide segment that can form class IIb bacteriocins Lactocin 705 with Lac705α (HY-P11138) . Lactocin 705β has no antibacterial activity when used alone. Lactocin 705β can be used for research on bacterial infections.

For research use only. We do not sell to patients.

CAS No.: 929219-92-1
Formula: C₁₄₇H₂₁₁N₄₇O₄₂
Molecular Weight:3308.54

Storage:

Please store the product under the recommended conditions in the Certificate of Analysis.

Lactocin 705β Chemical Structure

CAS No.: 929219-92-1

Size

Price

Stock

Quantity

Sample (0.1mg)

In-stock

(In Japan)

Apply Now

Get Quote Ask For Quote & Lead Time Consult sales personnel for more information Check price and availability Get Quote Ask For Quote & Lead Time Consult sales personnel for more information Check price and availability

Bulk Inquiry

Amount: USD 0.00

* Please select Quantity before adding items.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity

Description

Chemical Information

CAS No. 929219-92-1
Molecular Weight 3308.54
Formula C₁₄₇H₂₁₁N₄₇O₄₂
Synonyms

Lac705β
Sequence

Gly-Phe-Trp-Gly-Gly-Leu-Gly-Tyr-Ile-Ala-Gly-Arg-Val-Gly-Ala-Ala-Tyr-Gly-His-Ala-Gln-Ala-Ser-Ala-Asn-Asn-His-His-Ser-Pro-Ile-Asn-Gly
Sequence Shortening

GFWGGLGYIAGRVGAAYGHAQASANNHHSPING
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (258 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. Castellano P, et al. Molecular view by fourier transform infrared spectroscopy of the relationship between lactocin 705 and membranes: speculations on antimicrobial mechanism. Appl Environ Microbiol. 2007 Jan;73(2):415-20.

Calculators

Molarity Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Dilution Calculator

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

100 mg

Get Quote In-stock