NEP(1-40) TFA

Cat. No.: HY-P1242A: FAQs
Data Sheet Handling Instructions

Molarity Calculator

NEP(1-40) TFA is a Nogo-66 receptor (NgR) antagonist peptide, reversing the injury-induced shift in distribution of microglia morphologies by limiting myelin-based inhibition.

For research use only. We do not sell to patients.

NEP(1-40) TFA Chemical Structure

Size		Stock
50 mg		Get quote
100 mg		Get quote
250 mg		Get quote
Other size		Get quote

Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other In-stock Forms of NEP(1-40) TFA:

Other Forms of NEP(1-40) TFA:

NEP(1-40) In-stock

1 Publications Citing Use of MCE NEP(1-40) TFA

•Oncol Lett. May 27, 2022.

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

Biological Activity
Purity & Documentation
References
Customer Review

Description

NEP(1-40) TFA is a Nogo-66 receptor (NgR) antagonist peptide, reversing the injury-induced shift in distribution of microglia morphologies by limiting myelin-based inhibition^[1].

In Vivo

NEP(1-40) (89 μg/kg, ip, 15 min and 19 h post-injury) administration further shifts distributions of microglia away from an injury-induced activated morphology towards greater proportions of rod and macrophage-like morphologies^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model:	74 male Sprague-Dawley rats (328-377 g)^[1].
Dosage:	89 μg/kg (97.5% PBS and 2.5% DMSO).
Administration:	IP, 15 min and 19 h post-injury.
Result:	Reduced NgR function immediately post-injury. Increased number of amoeboid microglia/macrophages at 2 days post-injury

Molecular Weight

4739.13

Formula

C₂₀₈H₃₂₅F₃N₅₆O₆₇

Sequence

Arg-Ile-Tyr-Lys-Gly-Val-Ile-Gln-Ala-Ile-Gln-Lys-Ser-Asp-Glu-Gly-His-Pro-Phe-Arg-Ala-Tyr-Leu-Glu-Ser-Glu-Val-Ala-Ile-Ser-Glu-Glu-Leu-Val-Gln-Lys-Tyr-Ser-Asn-Ser-NH2

Sequence Shortening

RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Handling Instructions (2659 KB)

References

[1]. Jenna M Ziebell, et al. Nogo Presence Is Inversely Associated With Shifts in Cortical Microglial Morphology Following Experimental Diffuse Brain Injury. Neuroscience. 2017 Sep 17;359:209-223. [Content Brief]

Molarity Calculator
Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

The dilution calculator equation

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

NEP(1-40)OthersTraumaticbraininjuryTBIMicrogliaNogomyelinoligodendrocytesInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks