Copy Link Print Information

B7-1/CD80 Protein, Mouse (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

B7-1/CD80 Protein, Mouse (HEK293, Fc) is not only expressed on APCs, but also is expressed on T cells. B7-1:PD-L1 interaction can inhibit T cell proliferation and cytokine production.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • B7-1/CD80 Protein, Mouse (HEK293, Fc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

B7-1/CD80 Protein, Mouse (HEK293, Fc) is not only expressed on APCs, but also is expressed on T cells. B7-1:PD-L1 interaction can inhibit T cell proliferation and cytokine production[1].

Background

B7-1 and PD-L1 interact with an affinity intermediate to that of B7-1:CD28 and B7-1:CTLA-4. The PD-L1:B7-1 interface overlaps with the B7-1:CTLA-4 and PD-L1:PD-1 interfaces. B7-1:PD-L1 interaction can inhibit T cell proliferation and cytokine production[1].

Verified Bioactivity

1.Immobilized Recombinant Mouse CTLA-4 (C-6His) at 1 μg/mL (100 μL/well) can bind Recombinant Mouse B7-1 (C-Fc).The ED50 of Recombinant Mouse B7-1 (C-Fc) is 1-5 ng/mL.
2.Loaded Recombinant Mouse B7-1 on Pro-A Biosensor, can bind Recombinant Mouse CTLA-4 with an affinity constant of 0.1-5.0 nM as determined in BLI assay.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-hFc
  • Accession

    Q00609 (V38-K245)

  • Gene ID
    12519  [NCBI]
  • Molecular Construction
    • N-term
    • B7-1 (V38-K245)
      Accession # Q00609
    • hFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD80; B-Lymphocyte Activation Antigen B7; Prev. CD28LG1; LAB7; Prev. CD28LG; BB1; T-Lymphocyte Activation Antigen CD80; B7; Activation B7-1 Antigen; Costimulatory Molecule Variant IgV-CD80; B7.1; Costimulatory Factor CD80; B7-1; CD80 Molecule; CD80 Antige

  • AA Sequence

    VDEQLSKSVKDKVLLPCRYNSPHEDESEDRIYWQKHDKVVLSVIAGKLKVWPEYKNRTLYDNTTYSLIILGLVLSDRGTYSCVVQKKERGTYEVKHLALVKLSIKADFSTPNITESGNPSADTKRITCFASGGFPKPRFSWLENGRELPGINTTISQDPESELYTISSQLDFNTTRNHTIKCLIKYGDAHVSEDFTWEKPPEDPPDSK

  • Predicted Molecular Mass

    50.8 kDa

  • Molecular Weight

    Approximately 72 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Manish J Butte, et al. Programmed death-1 ligand 1 interacts specifically with the B7-1 costimulatory molecule to inhibit T cell responses. Immunity. 2007 Jul;27(1):111-22. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • B7-1/CD80 Protein, Mouse (HEK293, Fc) Product Image
    1/16
  • B7-1/CD80 Protein, Mouse (HEK293, Fc) Product Image