CD14 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

CD14 Protein, Human (HEK293, His) is a recombinant human CD14 expressed in HEK 293 cells with a His tag at the N-terminus. CD14 Protein is an efficient target for recombinant immunoglobulin vaccine constructs that deliver T cell epitopes.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

CD14 Protein, Human (HEK293, His) is a recombinant human CD14 expressed in HEK 293 cells with a His tag at the N-terminus. CD14 Protein is an efficient target for recombinant immunoglobulin vaccine constructs that deliver T cell epitopes[1][2].

Background

CD14, preferentially expressed on the surface of monocytes/macrophages, is a glycophosphatidylinositol‐linked protein, which is also part of the lipopolysaccharide (LPS) receptor complex. CD14 binds LPS and acts as a pattern recognition receptor (PRR). In addition to binding LPS and other bacterial products such as peptidoglycan and lipomannans, human CD14 has been suggested to mediate phagocytosis of bacteria and apoptotic cells[1][2].

Verified Bioactivity

Measured by its ability to enhance LPS-stimulated IL-8 secretion by THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 4.364 ng/mL in the presence of 2 μg/mL LPS. Corresponding to a specific activity is 2.291×10^5 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to enhance LPS-stimulated IL-8 secretion by THP‑1 human acute monocytic leukemia cells. The ED50 for this effect is 4.364 ng/mL in the presence of 2 μg/mL LPS. Corresponding to a specific activity is 2.291×10^5 U/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD14 (T20-C352)
      Accession # P08571
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CD14; Monocyte Differentiation Antigen CD14; CD14 Molecule; CD14 Antigen; Myeloid Cell-Specific Leucine-Rich Glycoprotein; My23 Antigen

  • AA Sequence

    TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPAC

  • Predicted Molecular Mass

    36.8 kDa

  • Molecular Weight

    Approximately 49-54 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00