1. Recombinant Proteins
  2. CD Antigens
  3. CD14 Protein, Human (HEK293, His)

CD14 Protein, Human (HEK293, His)

Cat. No.: HY-P7786
Handling Instructions

CD14 Protein, Human (HEK293, His) is a recombinant human CD14 expressed in HEK 293 cells with a His tag at the N-terminus. CD14 Protein is an efficient target for recombinant immunoglobulin vaccine constructs that deliver T cell epitopes[1][2].

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $95 In-stock
Estimated Time of Arrival: December 31
50 μg $285 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

CD14 Protein, Human (HEK293, His) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

HEK 293

Accession

P08571 (T20-C352)

Gene ID

929

Synonyms
rHuCD14, His; Monocyte Differentiation Antigen CD14; Myeloid Cell-Specific Leucine-Rich Glycoprotein; CD14
AA Sequence

TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPAC

Molecular Weight

Approximately 54 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

CD14, preferentially expressed on the surface of monocytes/macrophages, is a glycophosphatidylinositol‐linked protein, which is also part of the lipopolysaccharide (LPS) receptor complex. CD14 binds LPS and acts as a pattern recognition receptor (PRR). In addition to binding LPS and other bacterial products such as peptidoglycan and lipomannans, human CD14 has been suggested to mediate phagocytosis of bacteria and apoptotic cells[1][2].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD14 Protein, Human (HEK293, His)
Cat. No.:
HY-P7786
Quantity:
MCE Japan Authorized Agent: