Copy Link Print Information

GDF-15 Protein, Mouse (HEK293, Fc)

3 Cited Publications
Customer Review

Based on 3 publication(s) in Google Scholar

Growth differentiation factor 15 (GDF-15) is a polypeptide hormone belonging to the transforming growth factor β (TGF-β) superfamily. GDF-15 is also known as non-steroidal anti-inflammatory drug activating Gene-1 (NAG-1), placental transforming growth factor-β (PTGFB), prostate-derived factor (PDF), and placental bone morphogenetic protein (PLAB). GDF-15 binds to glial cell-derived neurotrophic factor (GDNF) family receptor alpha-like protein (GFRAL) and is involved in aging, cancer, and metabolic processes. GFRAL-GDF15 does not affect SMAD activity and activates intracellular signals including RET, AKT, ERK1/2, and phospholipase C (PLCγ). GDF-15 Protein, Mouse (HEK293, Fc) has 115 amino acids expressed by HEK293 cells with N-terminal hFc tag and Fc co-transfection.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for GDF-15 Protein, Mouse (HEK293, Fc)
  • Experimental Validation Results for GDF-15 Protein, Mouse (HEK293, Fc)
  • Experimental Validation Results for GDF-15 Protein, Mouse (HEK293, Fc)
  • Experimental Validation Results for GDF-15 Protein, Mouse (HEK293, Fc)
  • Experimental Validation Results for GDF-15 Protein, Mouse (HEK293, Fc)
  • GDF-15 Protein, Mouse (HEK293, Fc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Growth differentiation factor 15 (GDF-15) is a polypeptide hormone belonging to the transforming growth factor β (TGF-β) superfamily. GDF-15 is also known as non-steroidal anti-inflammatory drug activating Gene-1 (NAG-1), placental transforming growth factor-β (PTGFB), prostate-derived factor (PDF), and placental bone morphogenetic protein (PLAB). GDF-15 binds to glial cell-derived neurotrophic factor (GDNF) family receptor alpha-like protein (GFRAL) and is involved in aging, cancer, and metabolic processes. GFRAL-GDF15 does not affect SMAD activity and activates intracellular signals including RET, AKT, ERK1/2, and phospholipase C (PLCγ)[1]. GDF-15 Protein, Mouse (HEK293, Fc) has 115 amino acids expressed by HEK293 cells with N-terminal hFc tag and Fc co-transfection.

Background

Growth differentiation factor 15 (GDF-15) is a polypeptide hormone belonging to the transforming growth factor β (TGF-β) superfamily. GDF-15 was highly expressed in placenta, low in prostate and colon, and to some extent in kidney. So GDF-15 is also known as placental transforming growth factor PGF-β, placental bone morphogenetic protein PLAB, and prostatus-derived factor PDF. GDF-15 has a wide range of biological functions in physiology and pathology, especially in aging, cancer, and metabolic processes. GDF-15 is initially stored in the extracellular matrix (ECM), where it undergoes proteolytic hydrolysis upon external stimulation to form an active form that is quickly secreted into circulation. In mouse cardiomyocytes, the cleavage process of GDF-15 may be catalyzed by the enzymes of the PCSK family, resulting in a mature dimer form. Upstream of the GDF15 promoter site, there are binding sites for various transcription factors, including specific protein 1 (Sp1), early growth response protein 1 (Egr-1), p53 and COUP transcription factor 1 (COUP-TF1). The receptor of GDF-15 is alpha-like protein (GFRAL), a receptor of the glial cell derived neurotrophic factor (GDNF) family. The GFRAL-GDF15 complex binds to the tyrosine kinase co-receptor RET, leading to RET phosphorylation. Subsequently, GFRAL-GDF15 continued to activate the intracellular signaling pathways of AKT, ERK1/2, and phospholipase C (PLCγ), but not the SMAD pathway. GDF-15 is overexpressed during and after many pathological states such as tissue injury and inflammation. The stimulating factors that contribute to this result include oxidized low-density lipoprotein (oxLDL), cytokines, and growth factors such as IL-1β, TNF-α, angiotensin II, macrophage colony-stimulating factor M-CSF, and TGFβ. GDF-15, also known as the NSAIDS drug activator gene NAG-1, may play an anti-inflammatory role by inhibiting macrophage activation. GDF-15 also inhibits the activity of NFκB or the expression of several cytokines, including interferon (IFN-γ), interleukin-6 (IL-6), monocyte chemotactic protein-1 (MCP-1), and tumor necrosis factor-α (TNF-α). GDF-15 has significant resistance to endotoxin-induced sepsis caused by acute kidney injury (AKI) and myocardial dysfunction. GDF-15 also appears to promote tumor growth in the later stages of malignancy. Elevated serum GDF15 levels have been reported as potential biomarkers for cancer progression, including breast, colon, pancreatic, and prostate tumors, among others. In human and cynomolgus monkeys, the amino acid sequence similarity of GDF-15 protein was high, and the similarity rate was 91.56%. Compared with the amino acid sequences of mice and rats, the similarity of human GDF-15 was low (59.73% and 59.39%, respectively)[1].

In Vivo

GDF-15 knockout mice show smaller Platinum-based treatment-induced anorexia and weight loss, while GDF-15 neutralization with the monoclonal antibody mAB1 improves survival[2].

Verified Bioactivity

Immobilized Mouse GFRAL-His at 2 μg/mL (100μL/well) on the plate. Dose response curve for Mouse GDF15-hFc with the EC50 ≤ 6.5 ng/mL determined by ELISA.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag N-hFc
  • Accession

    Q9Z0J7 (S189-A303)

  • Gene ID
    23886  [NCBI]
  • Molecular Construction
    • N-term
    • hFc
    • GDF-15 (S189-A303)
      Accession # Q9Z0J7
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    GDF15; Placental Bone Morphogenetic Protein; Growth Differentiation Factor 15; Macrophage Inhibitory Cytokine 1; MIC-1; NSAID-Activated Gene 1 Protein; NAG-1; NSAID-Regulated Gene 1 Protein; PTGFB; Placental TGF-Beta; PLAB; GDF-15; MIC1; NRG-1; PDF; NSAID

  • AA Sequence

    SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA

  • Predicted Molecular Mass

    37.9 kDa

  • Molecular Weight

    Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Assadi A, et al. GDF15, an update of the physiological and pathological roles it plays: a review. Pflugers Arch. 2020 Nov;472(11):1535-1546. [Content Brief]

[2]. Breen DM, et al. GDF-15 Neutralization Alleviates Platinum-Based Chemotherapy-Induced Emesis, Anorexia, and Weight Loss in Mice and Nonhuman Primates. Cell Metab. 2020 Dec 1;32(6):938-950.e6. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    GDF-15 Protein, Mouse (HEK293, Fc) purchased from MedChemExpress. Usage Cited in: J Nanobiotechnology. 2025 May 8;23(1):339. [Abstract]

    Customer Validation
     LDH activity was measured in LPS-injured primary ACE-II cells treated with GNPs or GNPsanti-SP-C containing GDF15 (1 μM; 24 h). Both treatments reduced LDH activity, with a greater reduction in the GNPsanti-SP-C group.

  • 1/16

    GDF-15 Protein, Mouse (HEK293, Fc) purchased from MedChemExpress. Usage Cited in: J Nanobiotechnology. 2025 May 8;23(1):339. [Abstract]

    Customer Validation
     ELISA was used to measure IL-1β and IL-6 in the supernatants of LPS-injured primary ACE-II cells treated with GNPs or GNPsanti-SP-C containing GDF15 (1 μM; 24 h). Both treatments reduced IL-1β and IL-6 significantly.

  • 1/16

    GDF-15 Protein, Mouse (HEK293, Fc) purchased from MedChemExpress. Usage Cited in: J Nanobiotechnology. 2025 May 8;23(1):339. [Abstract]

    Customer Validation
     Western blotting was used to analyze GDF15, SIRT1, p-AMPK, and AMPK in LPS-injured primary ACE-II cells treated with GNPs or GNPsanti-SP-C containing GDF15 (1 μM; 24 h). Both treatments increased GDF15, SIRT1, p-AMPK, and the p-AMPK/AMPK ratio.

  • 1/16

    GDF-15 Protein, Mouse (HEK293, Fc) purchased from MedChemExpress. Usage Cited in: J Nanobiotechnology. 2025 May 8;23(1):339. [Abstract]

    Customer Validation
     SA-βGal staining was used to assess senescence in LPS-injured primary ACE-II cells treated with GNPs or GNPsanti-SP-C containing GDF15 (1 μM; 24 h). Both treatments significantly reduced SA-βGal-positive cells.

  • 1/16

    GDF-15 Protein, Mouse (HEK293, Fc) purchased from MedChemExpress. Usage Cited in: J Nanobiotechnology. 2025 May 8;23(1):339. [Abstract]

    Customer Validation
     RT-qPCR was used to measure the senescence-related factors Cdkn2a, Cdkn1a, IL-8, and Mmp9 in LPS-injured primary ACE-II cells treated with GNPs or GNPsanti-SP-C containing GDF15 (1 μM; 24 h). Both treatments significantly reduced these factors.

  • GDF-15 Protein, Mouse (HEK293, Fc) Product Image
    1/16
  • Experimental Validation Results for GDF-15 Protein, Mouse (HEK293, Fc)
  • Experimental Validation Results for GDF-15 Protein, Mouse (HEK293, Fc)
  • Experimental Validation Results for GDF-15 Protein, Mouse (HEK293, Fc)
  • Experimental Validation Results for GDF-15 Protein, Mouse (HEK293, Fc)
  • Experimental Validation Results for GDF-15 Protein, Mouse (HEK293, Fc)
  • GDF-15 Protein, Mouse (HEK293, Fc) Product Image

  • GDF-15 Protein, Mouse (HEK293, Fc) purchased from MedChemExpress. Usage Cited in: J Nanobiotechnology. 2025 May 8;23(1):339. [Abstract]

    LDH activity was measured in LPS-injured primary ACE-II cells treated with GNPs or GNPsanti-SP-C containing GDF15 (1 μM; 24 h). Both treatments reduced LDH activity, with a greater reduction in the GNPsanti-SP-C group.

  • GDF-15 Protein, Mouse (HEK293, Fc) purchased from MedChemExpress. Usage Cited in: J Nanobiotechnology. 2025 May 8;23(1):339. [Abstract]

    ELISA was used to measure IL-1β and IL-6 in the supernatants of LPS-injured primary ACE-II cells treated with GNPs or GNPsanti-SP-C containing GDF15 (1 μM; 24 h). Both treatments reduced IL-1β and IL-6 significantly.

  • GDF-15 Protein, Mouse (HEK293, Fc) purchased from MedChemExpress. Usage Cited in: J Nanobiotechnology. 2025 May 8;23(1):339. [Abstract]

    Western blotting was used to analyze GDF15, SIRT1, p-AMPK, and AMPK in LPS-injured primary ACE-II cells treated with GNPs or GNPsanti-SP-C containing GDF15 (1 μM; 24 h). Both treatments increased GDF15, SIRT1, p-AMPK, and the p-AMPK/AMPK ratio.

  • GDF-15 Protein, Mouse (HEK293, Fc) purchased from MedChemExpress. Usage Cited in: J Nanobiotechnology. 2025 May 8;23(1):339. [Abstract]

    SA-βGal staining was used to assess senescence in LPS-injured primary ACE-II cells treated with GNPs or GNPsanti-SP-C containing GDF15 (1 μM; 24 h). Both treatments significantly reduced SA-βGal-positive cells.

  • GDF-15 Protein, Mouse (HEK293, Fc) purchased from MedChemExpress. Usage Cited in: J Nanobiotechnology. 2025 May 8;23(1):339. [Abstract]

    RT-qPCR was used to measure the senescence-related factors Cdkn2a, Cdkn1a, IL-8, and Mmp9 in LPS-injured primary ACE-II cells treated with GNPs or GNPsanti-SP-C containing GDF15 (1 μM; 24 h). Both treatments significantly reduced these factors.