TrkA Protein, Canine (HEK293, His)
Based on 1 Customer Validation
TrkA Protein (isoform 3) belongs to the nerve growth factor receptor family and can promote angiogenesis and has carcinogenic activity when overexpressed. TrkA Protein (isoform 3) antagonizes the anti-proliferative NGF-NTRK1 signaling that promotes the differentiation of neuronal precursors. TrkA Protein, Canine (HEK293, His) is the recombinant canine-derived TrkA protein, expressed by HEK293 , with N-His labeled tag.
- Species: Canine
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TrkA Protein (isoform 3) belongs to the nerve growth factor receptor family and can promote angiogenesis and has carcinogenic activity when overexpressed. TrkA Protein (isoform 3) antagonizes the anti-proliferative NGF-NTRK1 signaling that promotes the differentiation of neuronal precursors. TrkA Protein, Canine (HEK293, His) is the recombinant canine-derived TrkA protein, expressed by HEK293 , with N-His labeled tag.
Background
TrkA Protein (isoform 3) is only expressed in undifferentiated early neural progenitor cells, human neuroblastoma (NBs), and other subsets of neural crest-derived tumors, and can promote angiogenesis and exhibit carcinogenic activity when overexpressed. TrkA Protein (isoform 3) antagonizes the anti-proliferative NGF-NTRK1 signaling that promotes the differentiation of neuronal precursors[1].
Verified Bioactivity
Measured by its ability to inhibit NGF-induced proliferation of TF-1 human erythroleukemic cells. The ED50 for this effect is 1.122 μg/mL in the presence of 10 ng/mL of NGF (HY-P7660), corresponding to a specific activity is 891.2656 U/mg.
Technical Parameters
-
Species Canine
-
Source HEK293
-
Tag N-6*His
-
Accession
A0A8I3P078/XP_851619.3 (P285-K410)
-
Molecular Construction
-
N-term
-
His
-
TrkA (P285-K410)
Accession # A0A8I3P078/XP_851619.3 -
C-term
-
-
Protein Length
Full Length of Vascular endothelial growth factor D Chain
-
Synonyms
NTRK1; Tyrosine Kinase Receptor A; Neurotrophic Receptor Tyrosine Kinase 1; P140-TrkA; TRKA; Gp140trk; TRK; Trk-A; MTC; Neurotrophic Tyrosine Kinase Receptor Type 1; High Affinity Nerve Growth Factor Receptor; Tyrosine-Protein Kinase Receptor; Neurotrophi
-
AA Sequence
PASVQLHEAVELHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPVANETVRHGCLRLNQPTHVNNGNYTLLAANPSGRAAAFVMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSGDPVEK
-
Molecular Weight
Approximately 27-33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
