β-Amyloid (1-42), (rat/mouse)
Based on 9 publication(s) in Google Scholar
β-Amyloid (1-42), (rat/mouse) is a 42-aa peptide, shows cytotoxic effect on acute hippocampal slices, and used in the research of Alzheimer's disease.
For research use only. We do not sell to patients.
- Purity : 96.71%
- CAS No.: 166090-74-0
- Formula: C199H307N53O59S
- Molecular Weight:4418.02
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* The compound is unstable in solutions, freshly prepared is recommended.
Publications Citing Use of MedChemExpress (MCE) β-Amyloid (1-42), (rat/mouse)
More- Alzheimers Res Ther. 2025 Feb 1;17(1):35. [Abstract]
- Aging Cell. 2025 Feb;24(2):e14374. [Abstract]
- Food Funct. 2026 Feb 17. [Abstract]
- Int Immunopharmacol. 2025 Sep 10:165:115526. [Abstract]
- Bioorg Chem. 2024 Sep:150:107584. [Abstract]
- Sci Rep. 2023 Aug 21;13(1):13586. [Abstract]
- Brain Res Bull. 2026 Feb:235:111749. [Abstract]
- Neurosci Res. 2026 Aug:229:105090.
- Patent. US20240335439A1.
-
Flow Cytometry
-
Cell Imaging/Staining
-
WB
-
Cell Imaging/Staining
-
IF
Biological Activity
Description
IC50 & Target
Amyloid-β[1]
In Vitro
β-Amyloid Aggregation Guidelines (Following is our recommended protocol. This protocol only provides a guideline, and should be modified according to your specific needs). 1. Solid Aβ peptide was dissolved in cold hexafluoro-2-propanol (HFIP). The peptide was incubated at room temperature for at least 1h to establish monomerization and randomization of structure. 2. The HFIP was removed by evaporation, and the resulting peptide was stored as a film at -20 or -80 °C. 3. The resulting film was dissolved in anhydrous DMSO at 5 mM and then diluted into the appropriate concentration and buffer (serum- and phenol red-free culture medium) with vortexing. 4. Next, the solution was aged 48h at 4-8 °C. The sample was then centrifuged at 14000g for 10 min at 4-8 °C; the soluble oligomers were in the supernatant. The supernatant was diluted 10-200-fold for experiments. Methods vary depends on the downstream applications.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. Further protocols information, click here.
Induced Disease Models
Please do not refer to only one article to determine the experimental conditions. It is recommended to determine the optimal experimental conditions (animal strain, age, dosage, frequency and cycle, detection time and indicators, etc.) through preliminary experiments before the formal experiment.
β-Amyloid (1-42), (rat/mouse) can induce Alzheimer's disease[4].
Administration: 1 μg/μL • Hippocampal injection • single dose
(2) β-Amyloid (1-42) was injected bilaterally into the hippocampus of rat brain in a volume of 1.0 μL over a period of 0.1 μL/min using 1 μL Hamilton syringe.
Behavior: β-Amyloid (1-42) aggregates increased the retention time and altered the behavioral response in rats after 15 days of injection.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS No. 166090-74-0
-
Appearance Solid
-
Molecular Weight 4418.02
-
Formula C199H307N53O59S
-
Color White to off-white
-
Synonyms
Amyloid β-peptide (1-42) (rat/mouse)
-
Sequence
Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala
-
Sequence Shortening
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * The compound is unstable in solutions, freshly prepared is recommended.
Publications (9)
-
Journal Impact Factor
-
Most Recent
-
Alzheimers Res Ther
Delta-opioid receptor signaling alleviates neuropathology and cognitive impairment in the mouse model of Alzheimer's disease by regulating microglia homeostasis and inhibiting HMGB1 pathway. [Abstract]2025 Feb 1;17(1):35. PMID: 39893485 -
Aging Cell
Aβ -induced excessive mitochondrial fission drives type H blood vessels injury to aggravate bone loss in APP/PS1 mice with Alzheimer's diseases. [Abstract]2025 Feb;24(2):e14374. PMID: 39411913
β-Amyloid (1-42), (rat/mouse) purchased from MedChemExpress. Usage Cited in: Aging Cell. 2025 Feb;24(2):e14374. [Abstract]
Low-dose (1 μM) β-Amyloid (1-42), (rat/mouse) (Aβ) (1-15 μM) had a protective effect on cell survival, whereas 5 μM, 10 μM, and 15 μM Aβ significantly increased the apoptosis of ECs.
β-Amyloid (1-42), (rat/mouse) purchased from MedChemExpress. Usage Cited in: Aging Cell. 2025 Feb;24(2):e14374. [Abstract]
β-Amyloid (1-42), (rat/mouse) (Aβ) (5 μM) caused a higher quantity of small punctate and rounded mitochondria with aberrant morphology in ECs compared with the control group.
β-Amyloid (1-42), (rat/mouse) purchased from MedChemExpress. Usage Cited in: Aging Cell. 2025 Feb;24(2):e14374. [Abstract]
Dynamin-related protein 1 (Drp1) expression level ascertained that β-Amyloid (1-42), (rat/mouse) (Aβ) (5 μM) exerted an accelerative effect on mitochondrial fission by promoting the translocation of Drp1 from cytoplasm to mitochondria.
β-Amyloid (1-42), (rat/mouse) purchased from MedChemExpress. Usage Cited in: Aging Cell. 2025 Feb;24(2):e14374. [Abstract]
β-Amyloid (1-42), (rat/mouse) (Aβ) (5 μM) resulted in shortened and less interconnected mitochondrial structures in ECs.
-
Food Funct
From wild plant to functional ingredient: phytochemical insights and neuroprotective activity of Melissa officinalis subsp. altissima. [Abstract]2026 Feb 17. PMID: 41700802 -
Int Immunopharmacol
Aβ impairs bone vascular homeostasis in APP/PS1 mice via disrupting the mitochondrial fission-efferocytosis axis in macrophages. [Abstract]2025 Sep 10:165:115526. PMID: 40934542
β-Amyloid (1-42), (rat/mouse) purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2025 Sep 10:165:115526. [Abstract]
β-Amyloid (1-42), (rat/mouse) (Aβ) (10-20 μM) significantly decreased the fragments of Dil+ACs fragments phagocytized by BMDMs in a concentration-dependent manner.
-
Bioorg Chem
Discovery of cinnamamide/ester triazole hybrids as potential treatment for Alzheimer's disease. [Abstract]2024 Sep:150:107584. PMID: 38964146 -
Sci Rep
Amyloid-β slows cilia movement along the ventricle, impairs fluid flow, and exacerbates its neurotoxicity in explant culture. [Abstract]2023 Aug 21;13(1):13586. PMID: 37605005 -
Brain Res Bull
Targeting IGF2BP2 alleviates high fat diet aggravated Alzheimer's disease by inhibiting ferroptosis. [Abstract]2026 Feb:235:111749. PMID: 41587665 -
-
Solvent & Solubility
In Vitro:
DMSO : 25 mg/mL (5.66 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Please refer to the solubility information to select the appropriate solvent. The compound is unstable in solutions, freshly prepared is recommended.
Please refer to the solubility information to select the appropriate solvent. The compound is unstable in solutions, freshly prepared is recommended.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
In Vivo:
Select the appropriate dissolution method based on your experimental animal and administration route.
- For the following dissolution methods, please ensure to first prepare a clear stock solution using an In Vitro approach and then sequentially add co-solvents:
- To ensure reliable experimental results, the clarified stock solution can be appropriately stored based on storage conditions. As for the working solution for In Vivo experiments, it is recommended to prepare freshly and use it on the same day.
- The percentages shown for the solvents indicate their volumetric ratio in the final prepared solution. If precipitation or phase separation occurs during preparation, heat and/or sonication can be used to aid dissolution.
Add each solvent one by one: 10% DMSO 90% (20% SBE-β-CD in Saline)
Solubility: 2.5 mg/mL (0.57 mM); Suspended solution; Need ultrasonic
This protocol yields a suspended solution of 2.5 mg/mL. Suspended solution can be used for oral and intraperitoneal injection.
Taking 1 mL working solution as an example, add 100 μL DMSO stock solution (25.0 mg/mL) to 900 μL 20% SBE-β-CD in Saline, and mix evenly.
Preparation of 20% SBE-β-CD in Saline (4°C, storage for one week): 2 g SBE-β-CD powder is dissolved in 10 mL Saline, completely dissolve until clear.
In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:
-
-
-
-
Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Please enter your animal formula composition:
-
%DMSO +
Recommended: Keep the proportion of DMSO in working solution below 2% if your animal is weak.
-
%+
-
+%Tween-80 + +
-
%Saline +
The co-solvents required include: DMSO, . All of co-solvents are available by MedChemExpress (MCE). , Tween 80. All of co-solvents are available by MedChemExpress (MCE).
Working solution concentration: 0.22 mg/mL
Method for preparing stock solution: mg drug dissolved in μL DMSO. Stock solution concentration: mg/mL. * The compound is unstable in solutions, freshly prepared is recommended.
1. Take μL DMSO stock solution;
2. Add μL .
μL , mix evenly;
3. Then add μL Tween 80, mix evenly;
4. Then add μL
Please ensure that the stock solution in the first step is dissolved to a clear state, and add co-solvents in sequence. You can use ultrasonic heating (ultrasonic cleaner, recommended frequency 20-40 kHz), vortexing, etc. to assist dissolution.
Protocols
-
Amyloid: Congo Red Amyloid Staining
Congo red amyloid staining is a histochemical method used to detect extracellular amyloid deposits in tissue sections based on the affinity of Congo red dye for β-pleated sheet-rich protein aggregates. When bound to amyloid, Congo red produces characteristic apple-green birefringence under polarized light microscopy, which is widely regarded as a diagnostic feature of amyloid deposition in histopathology. The diagnostic principle relies on the combination of dye binding (congophilia) and optical anisotropy under polarized illumination, which distinguishes amyloid from most non-amyloid eosinophilic extracellular deposits in routine histological evaluation. Amyloid identification by Congo red staining remains a cornerstone in diagnostic pathology despite the availability of adjunct methods such as immunohistochemistry and mass spectrometry, particularly because of its ability to localize deposits directly within tissue architecture. The specificity of Congo red-positive deposits is incre
-
Cell Viability Determination by MTT Colorimetric Assay
The following protocol uses the MTT colorimetric assay as a classic literature-established method for assessing cell viability/metabolic activity in cultured mammalian cells. MTT[3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide] is reduced by metabolically active cells to a colored formazan product; the amount of formazan is quantified spectrophotometrically and provides an indirect measure of metabolically active viable cells. Importantly, MTT reduction reflects cellular oxidoreductase/metabolic activity rather than an absolute direct count of living cells, so changes in cellular metabolism can alter the signal independently of cell number.
-
Alzheimer’s Disease Modeling
Alzheimer’s Disease (AD) is a neurodegenerative disorder characterized by a progressive decline in cognitive functions and loss of specific types of neurons and synapses. Alzheimer's symptoms can be simulated in mice by injecting drugs (such as Aβ) or genetically modified.
Purity & Documentation
-
Data Sheet (296 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Mozes E, et al. A novel method for the rapid determination of beta-amyloid toxicity on acute hippocampal slices using MTT and LDH assays. Brain Res Bull. 2012 Apr 10;87(6):521-5. [Content Brief]
[2]. Lagunes T, et al. Abeta(1-42) induces abnormal alternative splicing of tau exons 2/3 in NGF-induced PC12 cells. An Acad Bras Cienc. 2014 Dec;86(4):1927-34. [Content Brief]
[3]. Stefania Sabella, et al. Capillary electrophoresis studies on the aggregation process of beta-amyloid 1-42 and 1-40 peptides. Electrophoresis. 2004 Oct;25(18-19):3186-94. [Content Brief]
[4]. Chennakesavan Karthick, et al. Time-dependent effect of oligomeric amyloid-β (1-42)-induced hippocampal neurodegeneration in rat model of Alzheimer's disease. Neurol Res. 2019 Feb;41(2):139-150. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. The compound is unstable in solutions, freshly prepared is recommended.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO | 1 mM | 0.2263 mL | 1.1317 mL | 2.2635 mL | 5.6586 mL |
| 5 mM | 0.0453 mL | 0.2263 mL | 0.4527 mL | 1.1317 mL |