AH-D peptide TFA
Based on 1 Customer Validation
AH-D peptide TFA is an antiviral peptide that selectively disrupts membrane structures within the size range of exosomes, inducing T-EXO depletion and enhancing cancer immunotherapy.
For research use only. We do not sell to patients.
- Purity: 98.78%
- Formula: C154H228N38O40S.xC2HF3O2
- Molecular Weight:3283.75 (free base)
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
Chemical Information
-
Appearance Solid
-
Molecular Weight 3283.75 (free base)
-
Formula C154H228N38O40S.xC2HF3O2
-
Color White to off-white
-
SMILES
OC(C(F)(F)F)=O.O=C([C@H](N)CO)NCC(N[C@@H](C(N[C@@H](C(N[C@@H](C(N[C@@H](C(N[C@@H](C(N[C@@H](C(N[C@@H](C(N[C@@H](C(N[C@@H](C(N[C@@H](C(N[C@@H](C(N[C@@H](C(N[C@@H](C(N[C@@H](C(N[C@@H](C(N[C@@H](C(N[C@@H](C(N[C@@H](C(N[C@@H](C(N[C@@H](C(N[C@@H](C(N[C@@H](C(N[C@@H](C(N[C@@H](C(N[C@@H](C(N)=O)CC(C)C)=O)CCCCN)=O)CO)=O)CCC(N)=O)=O)CC(C)C)=O)CC1=CNC2=CC=CC=C12)=O)[C@H](C)O)=O)CCCCN)=O)CC3=CC=CC=C3)=O)CC(O)=O)=O)[C@H](C)O)=O)CC(C)C)=O)C(C)C)=O)[C@H](C)O)=O)CS)=O)[C@@H](CC)C)=O)CC4=CNC5=CC=CC=C45)=O)CC(O)=O)=O)CC6=CNC7=CC=CC=C67)=O)C(C)C)=O)CC(O)=O)=O)CCCNC(N)=N)=O)CC(C)C)=O)CC8=CNC9=CC=CC=C89)=O)CO)=O.[x]
-
Sequence
d-{Ser-Gly-Ser-Trp-Leu-Arg-Asp-Val-Trp-Asp-Trp-Ile-Cys-Thr-Val-Leu-Thr-Asp-Phe-Lys-Thr-Trp-Leu-Gln-Ser-Lys-Leu-NH2}
-
Sequence Shortening
d-{SGSWLRDVWDWICTVLTDFKTWLQSKL-NH2}
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Purity & Documentation
-
Data Sheet (274 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
AH-D peptide TFA Related Classifications
HY-P10862A Related Classifications
Powered by Bioz