country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Country or Region:

United States

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P10844

Copy Link Print Information

ANK peptide

ANK peptide is a novel peptide designed based on the conserved residues of single ankyrin motif. ANK peptide is a synuclein-γ (SNCG) inhibitor that binds to SNCG and competes with SNCG-BubR1 interaction to enhance the sensitivity of breast cancer cells to antimicrotubule drugs such as nocodazole and paclitaxel. ANK peptide can be used in the study of cancer.

For research use only. We do not sell to patients.

CAS No.: 929207-58-9
Formula: C₁₅₂H₂₄₄N₅₂O₄₆S₂
Molecular Weight:3600.01

Storage:

Please store the product under the recommended conditions in the Certificate of Analysis.

ANK peptide Chemical Structure

CAS No.: 929207-58-9

Price

Stock

Quantity

Amount: USD 0.00

* Please select Quantity before adding items.

Use of MCE Products

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity

Description

Chemical Information

CAS No. 929207-58-9
Molecular Weight 3600.01
Formula C₁₅₂H₂₄₄N₅₂O₄₆S₂
Sequence

Lys-Gly-Asn-Ser-Ala-Leu-His-Val-Ala-Ser-Gln-His-Gly-His-Leu-Gly-Cys-Ile-Gln-Thr-Leu-Val-Arg-Tyr-Gly-Ala-Asn-Val-Thr-Met-Gln-Asn-His-Gly
Sequence Shortening

KGNSALHVASQHGHLGCIQTLVRYGANVTMQNHG
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Protocols

All Animals and Diseases

Breast Cancer Modeling
Breast cancer is a heterogeneous cancer, and it has been distinguished into four subtypes: luminal A, luminal B, HER2-positive and basal-like. Molecular mutations, epigenetic alterations, hormone exposure and immune microenvironment are related to the progression of breast cancer.

Purity & Documentation

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (258 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. Singh VK, et al. Synuclein-gamma targeting peptide inhibitor that enhances sensitivity of breast cancer cells to antimicrotubule drugs. Cancer Res. 2007 Jan 15;67(2):626-33. [Content Brief]

Calculators

Molarity Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Dilution Calculator

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Bioz

Keywords

MOQ

Minimum order quantity

100 mg

Get Quote In-stock

Other size

Get Quote