country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Country or Region:

United States

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P11000

Copy Link Print Information

INF7TAT

INF7TAT is an amphipathic cell-penetrating peptide that mediates intracellular delivery of CRISPR ribonucleoproteins. INF7TAT achieves endosomal escape via the INF7 fragment and cell binding via the TAT fragment. It enables intracellular delivery into primary human T cells and hematopoietic stem and progenitor cells, facilitating gene knockout and AAV-mediated homology-directed repair. INF7TAT can be used for genome editing-related research.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Formule: C₁₇₉H₂₆₈N₅₄O₄₈S
Masse moléculaire:3976.44

Stockage:

Please store the product under the recommended conditions in the Certificate of Analysis.

INF7TAT Chemical Structure

Stock

Quantité

Amount: USD 0.00

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Use of MCE Products

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Activité biologique
- Description
- In Vitro
Chemical Information
Pureté et documentation
Références
Calculators
Help & FAQs
Classifications
Bioz

Activité biologique

Description

In Vitro

INF7TAT is the amphipathic peptide backbone of the PERC delivery system, and its engineered variants INF7TAT‑A5K / INF7TAT‑P55 enable efficient intracellular delivery of Cas9 RNP and Cas12a RNP into human primary T cells and human primary hematopoietic stem and progenitor cells (HSPC) without electroporation equipment^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Chemical Information

Masse moléculaire 3976.44
Formule C₁₇₉H₂₆₈N₅₄O₄₈S
Sequence

Gly-Leu-Phe-Glu-Ala-Ile-Glu-Gly-Phe-Ile-Glu-Asn-Gly-Trp-Glu-Gly-Met-Ile-Asp-Gly-Trp-Tyr-Gly-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg
Sequence Shortening

GLFEAIEGFIENGWEGMIDGWYGYGRKKRRQRR
Livraison

Room temperature in continental US; may vary elsewhere.
Stockage

Please store the product under the recommended conditions in the Certificate of Analysis.

Pureté et documentation

Select Batch:

Pureté: 99.98%

Assay: 99.98%

ee.: 99.98%

Fiche technique (289 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Instruction de manipulation (2659 KB)

Références

[1]. Vo N, et al. Calcium Shock Enables Efficient and Programmable Particle Delivery for Genome Editing Applications. Advanced science (Weinheim, Baden-Wurttemberg, Germany). 2026 Apr;13(21):e10441.

[2]. Sahu SU, et al. Peptide-enabled ribonucleoprotein delivery for CRISPR engineering (PERC) in primary human immune cells and hematopoietic stem cells. Nature protocols. 2025 Oct;20(10):2735-2770. [Content Brief]

Calculators

Calculateur de molarité

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Calculateur de dilution

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Bioz

Keywords

MOQ

Minimum order quantity

100 mg

Obtenir un devis En stock

Other size

Obtenir un devis