TpD
TpD is a chimeric T-helper epitope. TpD has a special site that cathepsin can cut. Immunization with TpD produces a strong antibody response. TpD promotes long-term CD4 immune responses in animals and humans. TpD binds well to many human MHC class II types, mainly HLA-DRB1. It also binds some other HLA alleles like DRB3, DRB4, DRB5, DP, and DQ. TpD can be used to improve the immune response of peptide vaccines.
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- CAS No.: 1273551-45-3
- Formule: C158H264N38O42S3
- Masse moléculaire:3464.21
-
Stockage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Activité biologique
-
Chemical Information
- Pureté et documentation
- Références
-
Help & FAQs
Activité biologique
| NCT Number | Sponsor | Condition | Start Date |
Phase
|
|---|---|---|---|---|
| NCT01329991 | Plexxikon| | 2011-05 | PHASE1 |
Chemical Information
-
CAS No. 1273551-45-3
-
Masse moléculaire 3464.21
-
Formule C158H264N38O42S3
-
Sequence
Ile-Leu-Met-Gln-Tyr-Ile-Lys-Ala-Asn-Ser-Lys-Phe-Ile-Gly-Ile-Pro-Met-Gly-Leu-Pro-Gln-Ser-Ile-Ala-Leu-Ser-Ser-Leu-Met-Val-Ala-Gln
-
Sequence Shortening
ILMQYIKANSKFIGIPMGLPQSIALSSLMVAQ
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Please store the product under the recommended conditions in the Certificate of Analysis.
Pureté et documentation
Références
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
TpD Related Classifications
HY-P11090 Related Classifications
Powered by Bioz