Copy Link Print Information

IL-10 Protein, Human

4 Cited Publications
Customer Review

Based on 4 publication(s) in Google Scholar

IL-10 Protein, Human is an anti-inflammatory, immunomodulatory cytokine that regulates mucosal inflammation.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-10 Protein, Human
  • Experimental Validation Results for IL-10 Protein, Human
  • Experimental Validation Results for IL-10 Protein, Human
  • Experimental Validation Results for IL-10 Protein, Human
  • Experimental Validation Results for IL-10 Protein, Human
  • IL-10 Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-10 Protein, Human is an anti-inflammatory, immunomodulatory cytokine that regulates mucosal inflammation.

Background

Interleukin 10 (IL-10) is an anti-inflammatory, immunomodulatory cytokine that regulates mucosal inflammation. A promising alternative is interleukin 10 (IL-10), a cytokine with multiple anti-inflammatory and immunoregulatory activities, including inhibition of T-cell/macrophage activation and proinflammatory cytokine synthesis[1]. IL-10, a cytokine possessing strong anti-inflammatory properties, is under investigation for its therapeutic use as an immunosuppressant. The immunosuppressive actions of IL-10 and corticosteroids include inhibition of proinflammatory cytokine production by monocytes and polymorphonuclear leukocytes (IFN-γ, TNF-α, IL-1β, IL-6, GM-CSF) both at the protein and messenger RNA levels and prevention of mitogen-induced T-cell proliferation[2].

Verified Bioactivity

1.The ED50 is typically 1- 8 ng/mL as measured by MC/9-2 mouse mast cells in a cell proliferation assay.
2.Immobilized human IL10 at 2 μg/mL (100 μL/well) can bind Cynomolgus IL10RA-Fc and the EC50 of Cynomolgus IL10RA-Fc is ≤1 μg/mL.
3.Human IL-10 inhibits LPS-induced secretion of IL-6 by RAW264.7 cells. The ED50 for this effect is 0.1-0.2 ng/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P22301/NP_000563.1 (S19-N178)

  • Gene ID
    3586  [NCBI]
  • Molecular Construction
    • N-term
    • IL-10 (S19-N178)
      Accession # P22301/NP_000563.1
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL10; TGIF; Interleukin 10; T-Cell Growth Inhibitory Factor; IL-10; Interleukin-10; CSIF; Interleukin Family Protein; Cytokine Synthesis Inhibitory Factor; GVHDS; IL10A; IF2A

  • AA Sequence

    SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

  • Predicted Molecular Mass

    18.8 kDa

  • Molecular Weight

    Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol.
2.Lyophilized from a 0.22 μm filtered solution of PBS.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 0.1% SKL.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Fedorak RN, et al. Recombinant human interleukin 10 in the treatment of patients with mild to moderately active Crohn's disease. The Interleukin 10 Inflammatory Bowel Disease Cooperative Study Group. Gastroenterology. 2000 Dec;119(6):1473-82. [Content Brief]

[2]. Chakraborty A, et al. Pharmacodynamic interaction of recombinant human interleukin-10 and prednisolone using in vitro whole blood lymphocyte proliferation. J Pharm Sci. 2002 May;91(5):1334-42. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Human IL-10 inhibits LPS-induced secretion of IL-6 by RAW264.7 cells. The ED50 for this effect is 0.1559 ng/mL. Corresponding to a specific activity is 6.414×10^6 U/mg.

  • 1/16

    IL-10 Protein, Human purchased from MedChemExpress. Usage Cited in: Life Sci. 2026 Mar 1:388:124173. [Abstract]

    Customer Validation
     Induction of IgG4 by IL-4 and IL-10 in PBMCs from early pregnant and non-pregnant women (ELISA). IgG4 levels in EP PBMCs cultured with IL-4 and IL-10 (10 ng/mL) for 10d; IgG4 levels in NP PBMCs cultured with IL-4 and IL-10 for 10d;

  • 1/16

    IL-10 Protein, Human purchased from MedChemExpress. Usage Cited in: Life Sci. 2026 Mar 1:388:124173. [Abstract]

    Customer Validation
     IgG4 levels in PBMCs cultured with or without IL-4 and IL-10 (10 ng/mL) for 14 d.

  • 1/16

    IL-10 Protein, Human purchased from MedChemExpress. Usage Cited in: Cell. 2024 Apr 25;187(9):2288-2304.e27. [Abstract]

    Customer Validation
     Protein levels of total and phosphorylated STAT3 in CD8+ T cells treated with IL-6 or IL-10 (20 μg/mL) and taurine.

  • IL-10 Protein, Human Product Image
    1/16
  • Experimental Validation Results for IL-10 Protein, Human
  • Experimental Validation Results for IL-10 Protein, Human
  • Experimental Validation Results for IL-10 Protein, Human
  • Experimental Validation Results for IL-10 Protein, Human
  • Experimental Validation Results for IL-10 Protein, Human
  • IL-10 Protein, Human Product Image