M65 TFA
Based on 1 Customer Validation
M65 TFA is a deleted peptide of maxadilan (61 a.a.) with deletion of the residues between positions 24 and 42 and is a specific antagonist of PACAP type 1 receptor that inhibits ANP secretion and can be used for relevant researches.
Para uso exclusivo en investigación. No vendemos a pacientes.
- Pureza: 99.98%
- Fòrmula: C205H326N64O61S5.xC2HF3O2
- Peso molecular:4823.53 (free base)
-
Almacenamiento:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Actividad biológica
-
Chemical Information
-
Solvente y solubilidad
- Pureza y Documentación
- Referencias
-
Help & FAQs
Ver todos los productos específicos de isoformas PACAP Receptor
More
Actividad biológica
M65 (1 µM) completely blocks the cAMP accumulation stimulated by 100 nM of VIP, and partially inhibits the cAMP accumulation stimulated by 1 nM of maxadilan in rat cortical neurons[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Appearance Solid
-
Peso molecular 4823.53 (free base)
-
Fòrmula C205H326N64O61S5.xC2HF3O2
-
Color White to off-white
-
Sequence
Cys-Asp-Ala-Thr-Cys-Gln-Phe-Arg-Lys-Ala-Ile-Asp-Asp-Cys-Gln-Lys-Gln-Ala-His-His-Ser-Asn-Val-Pro-Gly-Asn-Ser-Val-Phe-Lys-Glu-Cys-Met-Lys-Gln-Lys-Lys-Lys-Glu-Phe-Lys-Ala-NH2 (Disulfide bridge:Cys1-Cys5,Cys14-Cys32)
-
Sequence Shortening
CDATCQFRKAIDDCQKQAHHSNVPGNSVFKECMKQKKKEFKA-NH2 (Disulfide bridge:Cys1-Cys5,Cys14-Cys32)
-
Envío
Room temperature in continental US; may vary elsewhere.
-
Almacenamiento
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvente y solubilidad
DMSO : 100 mg/mL (Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
H2O : ≥ 50 mg/mL
* "≥" means soluble, but saturation unknown.
Pureza y Documentación
-
Ficha de datos (292 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Instrucciones de manejo (2659 KB)
Referencias
[1]. Lerner EA, et al. Maxadilan, a PAC1 receptor agonist from sand flies. Peptides. 2007 Sep;28(9):1651-4. [Content Brief]
[2]. Uchida D, et al. Maxadilan is a specific agonist and its deleted peptide (M65) is a specific antagonist for PACAP type 1 receptor. Ann N Y Acad Sci. 1998 Dec 11;865:253-8. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
M65 TFA Related Classifications
HY-P4127A Related Classifications
Powered by Bioz