Cat. No.: HY-P0054

GLP-1(7-36), amide acetate

(Synonyms: Glucagon-like peptide-1 (GLP-1)(7-36), amide acetate; Human GLP-1 (7-36), amide acetate)

10 Cited Publications

고객리뷰

Based on 10 publication(s) in Google Scholar

GLP-1(7-36), amide acetate is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Purity: 99.01%
CAS No.: 1119517-19-9
화학식: C₁₄₉H₂₂₆N₄₀O₄₅.xC₂H₄O₂
분자량:3297.64 (free base)

보관:

Sealed storage, away from moisture and light.

Powder -80°C, 2 years , -20°C, 1 year

* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

GLP-1(7-36), amide acetate Chemical Structure

CAS No.: 1119517-19-9

사이즈

가격

재고

수량

Amount: USD 0.00

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity
- 제품 설명
- In Vitro
- In Vivo
Chemical Information
Publications (10)
용액&용해도
- In Vitro
- In Vivo
순도&문서
References
Calculators
Help & FAQs
Classifications
Bioz

Biological Activity

제품 설명

GLP-1(7-36), amide acetate is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells.

In Vitro

Cells treated with phorbol 12-myristate 13-acetate for 2 h has significantly higher active GLP-1(7-36), amide acetate concentrations in the media than those in the control. The glucose treatment also increases active GLP-1 secretion from cells in dose-dependent manner. Palmitic, oleic, linoleic or linolenic acid dose-dependently stimulated active GLP-1 secretion from cells. Active GLP-1 secretion is significantly greater with unsaturated fatty acids such as oleic, linoleic and linolenic acids than with palmitic acid. The treatment of NCI-H716 cells with CPE dose-dependently increases active GLP-1 concentrations in the media. A 37% increase is observed in active GLP-1 secretion from these cells at a concentration of 0.1 % CPE^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

Gastric administration of glucose increases active GLP-1(7-36) amide levels in the portal blood after 10 min, followed by a marked decrease at 30 min. The gastric administration of TO also increases active GLP-1 levels after 10 min, and followed by a decrease to basal levels at 60 min. Individually, glucose and TO increase the secretion of GLP-1 in a dose-dependent manner. Furthermore, the co-administration of glucose and TO additively increase peak GLP-1 levels. CPE-administered mice have higher active GLP-1 levels in the portal blood at 10 and 30 min than those in the control mice. When glucose is administered with CPE, active GLP-1 and insulin levels in the portal blood are slightly higher in CPE-administered mice than in the control mice. High-fat diet-fed C57BL/6J mice develop hyperglycaemia and impair glucose tolerance^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Chemical Information

CAS No. 1119517-19-9
Appearance Solid
분자량 3297.64 (free base)
화학식 C₁₄₉H₂₂₆N₄₀O₄₅.xC₂H₄O₂
Color White to off-white
Synonyms

Glucagon-like peptide-1 (GLP-1)(7-36), amide acetate; Human GLP-1 (7-36), amide acetate
Sequence

His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2
Sequence Shortening

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
선적

Room temperature in continental US; may vary elsewhere.

보관

Sealed storage, away from moisture and light

Powder	-80°C	2 years
	-20°C	1 year

* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Publications (10)

All Bio/Physico-chemical AssayCell Proliferation/Viability AssayFlow CytometryWB

Sort by:

Journal Impact Factor

J Pharm Anal

Baicalein: A potential GLP-1R agonist improves cognitive disorder of diabetes through mitophagy enhancement. [Abstract]

2024 Aug;14(8):100968. PMID: 39258173

GLP-1(7-36), amide acetate purchased from MedChemExpress. Usage Cited in: J Pharm Anal. 2024 Aug;14(8):100968. [Abstract]

GLP-1(7-36), amide acetate, as GLP-1 analogues, facilitated Ca²⁺ mobilization in a dose-dependent manner in GLP-1R-HEK293 cells.
MAbs

Functional GLP-1R antibodies identified from a synthetic GPCR-focused library demonstrate potent blood glucose control. [Abstract]

2021 Jan-Dec;13(1):1893425. PMID: 33706686

GLP-1(7-36), amide acetate purchased from MedChemExpress. Usage Cited in: MAbs. 2021 Jan-Dec;13(1):1893425. [Abstract]

TB-59-2 is a potent agonist in the cAMP assay with a similar EC₅₀ as the GLP-1(7-36), amide acetate (30 min) peptide.

GLP-1(7-36), amide acetate purchased from MedChemExpress. Usage Cited in: MAbs. 2021 Jan-Dec;13(1):1893425. [Abstract]

TB01-3 competed with GLP-1(7-36), amide acetate peptide for binding and inhibited the activities of TB01-3 binding in the absence and presence of GLP-1(7-36), amide acetate.
Int J Pept Res Ther

2026 Mar 10;32(2):38.
Int J Endocrinol

GLP-1/GLP-1R Signaling Regulates Ovarian PCOS-Associated Granulosa Cells Proliferation and Antiapoptosis by Modification of Forkhead Box Protein O1 Phosphorylation Sites. [Abstract]

2020 Jun 19;2020:1484321. PMID: 32655632

GLP-1(7-36), amide acetate purchased from MedChemExpress. Usage Cited in: Int J Endocrinol. 2020 Jun 19;2020:1484321. [Abstract]

GCs were isolated from the ovaries of PCOS model mice (day 54 of life) and treated with increasing doses of GLP-1(7-36), amide acetate (10, 100, and 1000 nM; 24-120 h). Cell viability was measured by CCK-8 assay. The results showed that 100 nM GLP-1(7-36), amide acetate significantly enhanced the viability of MGCs compared with the blank control group.

GLP-1(7-36), amide acetate purchased from MedChemExpress. Usage Cited in: Int J Endocrinol. 2020 Jun 19;2020:1484321. [Abstract]

Flow cytometry Annexin V-FITC/PI double staining was used to detect the apoptotic rate of PCOS MGCs in control group and GLP-1(7-36), amide acetate (10 nM, 100 nM, and 1000 nM) treated for 48 hours. The results showed that different concentrations of GLP-1(7-36), amide acetate inhibited the apoptosis of PCOS-associated MGCs treated by DHEA. After being treated for 48 hours, the percentage of apoptotic and late-apoptotic cells was 11.97%, 0.343%, 0.152%, and 1.162%, corresponding to the concentration of GLP-1(7-36), amide acetate of 0, 10, 100, and 1000 nM.

GLP-1(7-36), amide acetate purchased from MedChemExpress. Usage Cited in: Int J Endocrinol. 2020 Jun 19;2020:1484321. [Abstract]

Bcl-2, bax, and beta-actin were detected using their specific antibodies by the Western blot analysis for the PCOS MGCs with or without 100 nM GLP-1(7-36), amide acetate interference for 48 hours. The results showed that the expression of bcl-2 protein increased significantly after GLP-1(7-36), amide acetate intervention, while the expression of Bax decreased.
bioRxiv

2025 Nov 3.
Research Square Preprint

2024 Jan 9.
Patent

US20230278991A1.
Research Square Preprint

2023 May 22.
Patent

US20200283424A1.
Patent

US20200283424A1.

용액&용해도

In Vitro:

H₂O : 100 mg/mL (Need ultrasonic)

View the Complete Stock Solution Preparation Table

In Vivo:

Working Solution

For the following dissolution methods, please prepare the working solution directly:

It is recommended to prepare fresh solutions and use them promptly within a short period of time.

The percentages shown for the solvents indicate their volumetric ratio in the final prepared solution. If precipitation or phase separation occurs during preparation, heat and/or sonication can be used to aid dissolution.

Protocol 1

Add each solvent one by one: PBS

Solubility: 25 mg/mL; Clear solution; Need ultrasonic

순도&문서

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (282 KB)
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. Fujii Y et al. Ingestion of coffee polyphenols increases postprandial release of the active glucagon-like peptide-1(GLP-1(7-36)) amide in C57BL/6J mice. J Nutr Sci. 2015 Mar 3 [Content Brief]

Calculators

몰농도 계산기

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

농도 희석 계산기

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

GLP-1(7-36), amide acetate

10 Cited Publications

100 mg 견적 받기

Subscribe to the

MedChemExpress

Newsletter

상품명:
Cat. No.:
수량:
MCE Japan Authorized Agent:

상품명:
CAS No.:
Species:
Purity:
수량:

GLP-1(7-36), amide acetate

Peptide Library

Publications Citing Use of MedChemExpress (MCE) GLP-1(7-36), amide acetate

Biological Activity

Chemical Information

Publications (10)

용액&용해도

순도&문서

References

Calculators

Help & FAQs

GLP-1(7-36), amide acetate

Peptide Library

Publications Citing Use of MedChemExpress (MCE) GLP-1(7-36), amide acetate

Biological Activity

Chemical Information

Publications (10)

용액&용해도

순도&문서

References

Calculators

Help & FAQs

GLP-1(7-36), amide acetate Related Classifications

HY-P0054 Related Classifications