IL-3 Protein, Mouse

Customer Review

Based on 1 Customer Validation

IL-3 Protein, Mouse functions via specific cell surface receptors to stimulate the proliferation, differentiation and survival of haematopoietic cell lines.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

IL-3 Protein, Mouse functions via specific cell surface receptors to stimulate the proliferation, differentiation and survival of haematopoietic cell lines.

Background

Interleukin-3 (IL-3) is aglycoprotein belonging to the hematopoietic growth factor family that in preclinical in vitro and in vivo studies has exhibited a multilineage activity. Recombinant human interleukin-3 (rhIL-3) enhances the mobilization of peripheral blood progenitor cells by recombinant human granulocyte colony-stimulating factor (rhG-CSF)[1]. Human interleukin-3 (hIL-3) is a multipotent hematopoietic cytokine produced by mitogen and antigen-activated keratinocytes, T-lymphocytes, mast cells, NK cells, monocytes and endothelial cells. The hematopoietic progenitor cells are proliferated and differentiated with the help of hIL-3 protein into mature erythrocytes, mast cells, megakaryocytes and granulocytes. The potential use of hIL-3 protein has been extensively tested in various clinical applications such as bone marrow transplantation, hematological malignancies, cytopenias, aplastic anemia and various types of cancer[2].

Verified Bioactivity

The ED50 is <0.2 ng/mL as measured by M-NFS-60 cells, corresponding to a specific activity of >5.2 × 106 units/mg.

Results
  • Experimental Validation Results for IL-3 Protein, Mouse
    Measured in a cell proliferation assay using M-NFS-60 cells. The ED50 for this effect is 191.9 pg/mL, corresponding to a specific activity is 5.211×106 units/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-3 (D33-C166)
      Accession # P01586
    • C-term
  • Protein Length

    Partial

  • Synonyms

    rMuIL-3; Hematopoietic growth factor; Mast cell growth factor; MCGF; Multipotential colony-stimulating factor; P-cell-stimulating factor

  • AA Sequence

    DTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC

  • Molecular Weight

    Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

    • Experimental Validation Results for IL-3 Protein, Mouse
      ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00