Infection

Tunicamycin V (Tunicamycin A) is a nucleoside natural product that inhibits bacterial phospho-N-acetylmuramyl-pentapeptide transferase (MraY) with an IC₅₀ of 0.35?μM. Tunicamycin V has antibacterial activties.

Myristic acid-d₂ is the deuterium labeled Myristic acid. Myristic acid is a saturated 14-carbon fatty acid occurring in most animal and vegetable fats, particularly butterfat and coconut, palm, and nutmeg oils.

Sphingomyelin phosphodiesterase, Bacillus cereus is a sphingomyelin hydrolase and Insecticide. Sphingomyelin phosphodiesterase, Bacillus cereus catalyzes the decomposition of sphingomyelin into ceramide and phosphorylcholine. Sphingomyelin phosphodiesterase, Bacillus cereus causes rapid paralysis and death in injected insects, including German cockroaches and black cutworms. Sphingomyelin phosphodiesterase, Bacillus cereus reduces H₂O₂ production. Sphingomyelin phosphodiesterase, Bacillus cereus can be used in studies related to sepsis and endophthalmitis.

Cabotegravir-d₅ is deuterium labeled Cabotegravir.

Nitrofurantoin sodium is a potent and orally active antibacterial agent. Nitrofurantoin sodium acts as an antibiotic. Nitrofurantoin sodium can be used for the study of urinary tract infections (UTIs), including cystitis and kidney infections.

Talviraline is a non-nucleoside reverse transcriptase (NNRT) inhibitor that is primarily used to inhibit the replication of human immunodeficiency virus type 1 (HIV-1). Talviraline inhibits the viral replication process by binding to a specific site of HIV-1 reverse transcriptase (RT). Talviraline can be used to study the potential countermeasures and safety of HIV-1 infection.

3-Formyl rifamycin is an acid degradation product of the broad-spectrum antibiotic Rifampicin (HY-B0272). 3-Formyl rifamycin forms via acid hydrolysis of Rifampicin in an acidic environment.

SDZ285428 is a CYP51 inhibitor. SDZ285428 inhibits Trypanosoma cruzi (TC) CYP51 with I/E2 <1 (5 min) and I/E2=9 (1 h). SDZ285428 inhibits Trypanosoma brucei (TB) CYP51 with I/E2 <1 (5 min) and I/E2=35 (1 h).

cis-ACCP is an orally active antimetastatic matrix metalloproteinase-2 (MMP-2) selective inhibitor. cis-ACCP can inhibit MMP-2 and MMP-9 with IC₅₀ values of 4 μM and 20 μM, respectively. cis-ACCP can be used for the research of a variety of chronic diseases.

R 59-022 (DKGI-I) hydrochloride is a DGK inhibitor (IC₅₀: 2.8 µM). R 59-022 hydrochloride inhibits the phosphorylation of OAG to OAPA. R 59-022 hydrochloride is a 5-HT Receptor antagonist, and activates protein kinase C (PKC). R 59-022 hydrochloride potentiates thrombin-induced diacylglycerol production in platelets and inhibits phosphatidic acid production in neutrophils.

Cefodizime (sodium) (Standard) is the analytical standard of Cefodizime (sodium). This product is intended for research and analytical applications. Cefodizime sodium is a third generation cephalosporin antibiotic with a broad spectrum of antibacterial activity. Cefodizime sodium has no renal toxic effect, good tolerance and immune regulation activity, and can be used for the research of severe infections of the respiratory and urinary tracts[1][2].

Mp-4D7-pF2, a cell-penetrating bicyclic peptide, is a noncovalent SARS-CoV-2 main protease inhibitor with an IC₅₀ of 4.51 μM. Mp-4D7-pF2 has an antiviral activity against SARS-CoV-2 with no cytotoxicity. Mp-4D7-pF2 can used for COVID-19 infections research.

5'-O-TBDMS-dG is a modified nucleoside. 5'-O-DMT-2'-O-TBDMS-rI can be used in the synthesis of deoxyribonucleic acid or nucleic acid.

m-PEG10000-OH (mPEG10000-Hydroxy; Polyethylene glycol monomethyl ether 10000) is a hydroxyl-terminated methoxylated polyethylene glycol (PEG-based) compound that serves as a linker for PROTACs. m-PEG10000-OH is applicable to research on healthcare-associated infections.

Aureothricin is a dithiolopyrrolone (DTP) antibiotic first isolated from Streptomyces and exhibits relatively broad-spectrum antibiotic activity. Aureothricin can inhibit adhesion of human umbilical vein endothelial cells (HUVECs) to vitronectin.

BC-7013 is a novel semi-synthetic pleuromutilin derivative. BC-7013 has excellent activity against Gram-positive pathogenic bacteria. BC-7013 exhibits potent antibacterial properties against both Staphylococcus, Streptococcus and penicillin-resistant Streptococcus pneumoniae. BC-7013 has activity against Gram-positive pathogenic bacteria, BC-7013 is useful in the research of acute bacterial skin and skin structure infection (ABSSSI).

Methoxychlor is an organochlorine pesticide agent. Methoxychlor induces Ca² rise and apoptosis in HA59T cells.

Methdilazine is an orally active antibiotic (histamine antagonist). Methdilazine can inhibit various mycobacterium with MIC values at 5-15 μg/mL in vitro and in vivo, which can be used for the research of infectious diseases.

PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG. PMAP-36 with traditional antibiotics can enhance.

CHMFL-PI4K-127 (compound 15g) is an orally active, potent and high selective PfPI4K (Plasmodium falciparum PI4K kinase) inhibitor, with an IC₅₀ of 0.9 nM. CHMFL-PI4K-127 exhibits potent activity against 3D7 Plasmodium falciparum, with an EC₅₀ of 25.1 nM. CHMFL-PI4K-127 shows antimalaria efficacy.