Anthopleurin-A

Cat. No.: HY-P4898: FAQs
Data Sheet Handling Instructions

Molarity Calculator

Anthopleurin-A is a soidum channel toxin. Anthopleurin-A is selective for cardiac channels and has cardiotonic effect. Anthopleurin-A can be isolated from the sea anemone.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Anthopleurin-A Chemical Structure

Size		Stock
50 mg		Get quote
100 mg		Get quote
250 mg		Get quote
Other size		Get quote

Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other Forms of Anthopleurin-A:

Anthopleurin-A TFA Get quote

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

Biological Activity
Purity & Documentation
References
Customer Review

Description	Anthopleurin-A is a soidum channel toxin. Anthopleurin-A is selective for cardiac channels and has cardiotonic effect. Anthopleurin-A can be isolated from the sea anemone^[1]^[2].
In Vitro	Anthopleurin-A (2 nM-640 nM) increases the force of contractions of isolated cat heart papillary muscles^[2]. MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. Anthopleurin-A Related Antibodies
In Vivo	Anthopleurin-A (0.2 μg/kg/min i.v.) increases myocardial contractile force in anesthetized dogs^[2]. MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Molecular Weight	5131.72
Formula	C₂₂₀H₃₂₆N₆₄O₆₇S₆
Sequence	Gly-Val-Ser-Cys-Leu-Cys-Asp-Ser-Asp-Gly-Pro-Ser-Val-Arg-Gly-Asn-Thr-Leu-Ser-Gly-Thr-Leu-Trp-Leu-Tyr-Pro-Ser-Gly-Cys-Pro-Ser-Gly-Trp-His-Asn-Cys-Lys-Ala-His-Gly-Pro-Thr-Ile-Gly-Trp-Cys-Cys-Lys-Gln (Disulfide bridge: Cys4-Cys46,Cys6-Cys36,Cys29- Cys47)
Sequence Shortening	GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ (Disulfide bridge: Cys4-Cys46,Cys6-Cys36,Cys29- Cys47)
Shipping	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation	Data Sheet (260 KB) Handling Instructions (2659 KB)
References	[1]. Honma T, Shiomi K. Peptide toxins in sea anemones: structural and functional aspects. Mar Biotechnol (NY). 2006 Jan-Feb;8(1):1-10. [Content Brief] [2]. Scriabine A, et al. Cardiotonic effects of anthopleurin-A, a polypeptide from a sea anemone. J Cardiovasc Pharmacol. 1979 Sep-Oct;1(5):571-83. [Content Brief]

Anthopleurin-A Related Classifications

Molarity Calculator
Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

The dilution calculator equation

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Anthopleurin-ASodium ChannelNa channelsNa+ channelstoxincardiac channelcardiotonicsea anemoneInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks

Product Name			Lot #
Applicant Name *			Email Address *
Phone Number			Department *
Organization Name *			Country or Region *
Remarks

Name
Email *

	Sorry, but the email address you supplied was invalid.

Anthopleurin-A

Other Forms of Anthopleurin-A:

Anthopleurin-A Related Antibodies

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

Biological Activity

Purity & Documentation

References

Customer Review