GsAF-I
GsAF-I is a potent Nav and hERG1 channels blocker with IC50s of 0.36, 0.6, 1.28, 0.33, 1.2, 0.04 and 4.8 μM against Nav1.1, Nav1.2, Nav1.3, Nav1.4, Nav1.6, Nav1.7 and hERG1, respectively.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- Formel: C160H244N46O42S7
- Molecular Weight:3708.39
-
Speicherung:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biologische Aktivität
-
Chemical Information
- Reinheit & Dokumentation
- Verweise
-
Help & FAQs
Biologische Aktivität
IC50: 0.04 μM (Nav1.7), 0.33 μM (Nav1.4), 0.36 μM (Nav1.1), 0.6 μM (Nav1.2), 1.2 μM (Nav1.6), 1.28 μM (Nav1.3), 4.8 μM (hERG1)[1]
Chemical Information
-
Molecular Weight 3708.39
-
Formel C160H244N46O42S7
-
Sequence
Tyr-Cys-Gln-Lys-Trp-Leu-Trp-Thr-Cys-Asp-Ser-Glu-Arg-Lys-Cys-Cys-Glu-Asp-Met-Val-Cys-Arg-Leu-Trp-Cys-Lys-Lys-Arg-Leu-NH2 (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys25)
-
Sequence Shortening
YCQKWLWTCDSERKCCEDMVCRLWCKKRL-NH2 (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys25)
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Please store the product under the recommended conditions in the Certificate of Analysis.
Reinheit & Dokumentation
Verweise
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)
GsAF-I Related Classifications
HY-P5795 Related Classifications
Powered by Bioz