Cn2 toxin TFA (Synonyms: β-Mammal toxin Cn2 TFA)

Cat. No.: HY-P5807A Purity: 98.13%: FAQs
Data Sheet SDS COA Handling Instructions

Molarity Calculator

Cn2 toxin TFA (β-Mammal toxin Cn2 TFA) is a single-chain β-scorpion neurotoxic peptide that is the main toxin in scorpion venom. Cn2 toxin (TFA) specifically targets mammalian voltage-gated sodium channels (VGSC) Nav1.6.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Cn2 toxin TFA Chemical Structure

Size	Price	Stock	Quantity
500 μg	USD 590	In-stock	Estimated Time of Arrival: December 31
1 mg	USD 950	In-stock	Estimated Time of Arrival: December 31
5 mg	USD 2400	In-stock	Estimated Time of Arrival: December 31
10 mg		Get quote
50 mg		Get quote

or Bulk Inquiry

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other Forms of Cn2 toxin TFA:

Cn2 toxin Get quote

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

Biological Activity
Purity & Documentation
References
Customer Review

Description

Molecular Weight

7588.60 (free base)

Formula

C₃₃₆H₄₉₆N₉₀O₉₆S₈.xC₂HF₃O₂

Appearance

Solid

Color

White to off-white

Sequence

Lys-Glu-Gly-Tyr-Leu-Val-Asp-Lys-Asn-Thr-Gly-Cys-Lys-Tyr-Glu-Cys-Leu-Lys-Leu-Gly-Asp-Asn-Asp-Tyr-Cys-Leu-Arg-Glu-Cys-Lys-Gln-Gln-Tyr-Gly-Lys-Gly-Ala-Gly-Gly-Tyr-Cys-Tyr-Ala-Phe-Ala-Cys-Trp-Cys-Thr-His-Leu-Tyr-Glu-Gln-Ala-Ile-Val-Trp-Pro-Leu-Pro-Asn-Lys-Arg-Cys-Ser-NH2 (Disulfide bridge:Cys12-Cys65;Cys16-Cys41;Cys25-Cys46;Cys29-Cys48)

Sequence Shortening

KEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGGYCYAFACWCTHLYEQAIVWPLPNKRCS-NH2 (Disulfide bridge:Cys12-Cys65;Cys16-Cys41;Cys25-Cys46;Cys29-Cys48)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Solvent & Solubility

In Vitro:

DMSO : 50 mg/mL (Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Molarity Calculator
Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

In Vivo Dissolution Calculator

Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.

Calculation results:

Working solution concentration: mg/mL

Purity & Documentation

Purity: 98.13%

Select Batch:

Data Sheet (269 KB) SDS (0 KB)

COA (244 KB) RP-HPLC (111 KB) MS (221 KB)

Handling Instructions (2659 KB)

References

[1]. Chen R, et al. Conserved functional surface of antimammalian scorpion β-toxins. J Phys Chem B. 2012 Apr 26;116(16):4796-800. [Content Brief]

Cn2 toxin TFA Related Classifications

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Cn2 toxinβ-Mammal toxin Cn2Sodium ChannelNa channelsNa+ channelsCn2Neurotoxic peptideVGSCInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks