M-CSF Protein, Human (CHO)

9 Cited Publications
Customer Review

Based on 9 publication(s) in Google Scholar

M-CSF (CSF-1) protein is a homodimeric hematopoietic growth factor and proinflammatory cytokine, belonging to the colony stimulating factor. M-CSF can act specifically on the monocyte-macrophage lineage, drive monocyte proliferation and differentiation into macrophages/osteoclasts, and induce M1 macrophages to enhance ADCC anti-tumor activity and M2 macrophages to promote VEGF angiogenesis. M-CSF Protein, Human (CHO) is a recombinant human M-CSF protein expressed in CHO cells with tag-free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: CHO
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

M-CSF (CSF-1) protein is a homodimeric hematopoietic growth factor and proinflammatory cytokine, belonging to the colony stimulating factor. M-CSF can act specifically on the monocyte-macrophage lineage, drive monocyte proliferation and differentiation into macrophages/osteoclasts, and induce M1 macrophages to enhance ADCC anti-tumor activity and M2 macrophages to promote VEGF angiogenesis[1][2][3][4]. M-CSF Protein, Human (CHO) is a recombinant human M-CSF protein expressed in CHO cells with tag-free.

Background

1. M-CSF Protein Protein Characteristics[1][2][3]
M-CSF, or macrophage colony stimulating factor, CSF-1, is a disulfide-linked homodimer belonging to the colony stimulating factor (CSF) family. M-CSF is a hematopoietic growth factor and proinflammatory cytokine with multiple glycosylation sites, belonging to the hematopoietic growth factor family along with GM-CSF and G-CSF. M-CSF affects the survival and function of tissue macrophages and has anti-tumor activity[1]. M-CSF is expressed in a variety of cells, such as fibroblasts, endothelial cells, stromal cells, macrophages, smooth muscle cells and osteoblasts, and has multiple subtypes. M-CSF can be a secreted glycoprotein, a cell surface protein and a proteoglycan, binding to its receptor CSF1R[2]. M-CSF can specifically act on the monocyte-macrophage lineage, participate in the development and proliferation of monocyte/macrophage lineage cells, and participate in the induction of osteoclasts. Osteoclasts are very important for the destruction of bone and cartilage and the changes in periarticular osteoporosis in patients with rheumatoid arthritis[3].
2. M-CSF Protein Functional Characteristics[1][4]
M-CSF is regulated by LPS and IFN-γ upstream, and regulates inflammatory factors such as IL-12 and TNF-α downstream. M-CSF induces macrophage polarization to M1 type, and enhances antibody-dependent cellular cytotoxicity (ADCC) by upregulating surface molecules such as CD80 and CD16, exerting anti-tumor effects. M-CSF may induce macrophage polarization to M2 type, promoting VEGF secretion and angiogenesis.
3. Application of M-CSF Protein[1][4][5][6]
Oncology: Clinical trials have shown that M-CSF combined with monoclonal antibodies can enhance tumor-targeted killing, but its pro-angiogenic effect may promote metastasis.
Infection and Immunity: Enhance the antifungal (such as Candida) and anti-tuberculosis activity of macrophages, and use it to treat infections in immunocompromised patients.
Hematopoietic Repair: Restore monocyte counts after chemotherapy/transplantation and shorten the neutrophil deficiency period.
Bone Disease: Regulate osteoclasts, used in osteoporosis and rheumatoid arthritis research.

Verified Bioactivity

The ED50 is <5 ng/mL as measured by Murine M-NFS-60 cells, corresponding to a specific activity of >2 × 105 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 0.9606 ng/mL, corresponding to a specific activity is 1.041×106 U/mg.

Technical Parameters

  • Species Human
  • Source CHO
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • M-CSF (E33-S190)
      Accession # P09603-3
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CSF1; Macrophage Colony Stimulating Factor 1; Colony Stimulating Factor 1; Lanimostim; MCSF; MGC31930; Proteoglycan Macrophage Colony-Stimulating Factor; PG-M-CSF; Macrophage Colony-Stimulating Factor 1; CSF-1; M-CSF; CSF1-HERV-LTR71B Fusion Protein; Colo

  • AA Sequence

    EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS

  • Molecular Weight

    Approximately 18-22 kDa under reduced (R) conditions, 32-40 kDa under non reducing (N) conditions, based on SDS-PAGE due to the glycosylation.

  • Glycosylation

    Yes

  • Structure/Form

    Disulfide-linked homodimer

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized after extensive dialysis against PBS.
2.Lyophilized after extensive dialysis against PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00