1. GPCR/G Protein Neuronal Signaling
  2. Neuropeptide Y Receptor
  3. NNC0165-1273 TFA

NNC0165-1273 (TFA) is the trifluoroacetic acid of NNC0165-1273 (HY-P11291). NNC0165-1273 is an analog of gut hormone peptide YY (PYY3-36). NNC0165-1273 has a superior affinity for Y2 receptor over Y1, Y4, and Y5 receptor. NNC0165-1273 has a potent anorectic effect and significantly reduces nighttime and ghrelin-induced food intake by producing early satiety. NNC0165-1273 inhibits ghrelin-induced cFos expression in NPY/AgRP neurons. NNC0165-1273 can be used for antiobesity therapies research.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

NNC0165-1273 TFA

NNC0165-1273 TFA Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other Forms of NNC0165-1273 TFA:

Top Publications Citing Use of Products

View All Neuropeptide Y Receptor Isoform Specific Products:

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

NNC0165-1273 (TFA) is the trifluoroacetic acid of NNC0165-1273 (HY-P11291). NNC0165-1273 is an analog of gut hormone peptide YY (PYY3-36). NNC0165-1273 has a superior affinity for Y2 receptor over Y1, Y4, and Y5 receptor. NNC0165-1273 has a potent anorectic effect and significantly reduces nighttime and ghrelin-induced food intake by producing early satiety. NNC0165-1273 inhibits ghrelin-induced cFos expression in NPY/AgRP neurons. NNC0165-1273 can be used for antiobesity therapies research[1].

Molecular Weight

4136.54 (free base)

Formula

C186H280N54O54·xC2HF3O2

Appearance

Solid

Sequence

Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Trp-Val-Thr-Arg-Gln-{β-homoArg}-Tyr-NH2

Sequence Shortening

IKPEAPGEDASPEELNRYYASLRHYLNWVTRQ-{β-homoArg}-Y-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NNC0165-1273 TFA
Cat. No.:
HY-P11291A
Quantity:
MCE Japan Authorized Agent: