RCP168
RCP168 is a highly selective and affinity CXCR4 receptor antagonist (IC50=5 nM). RCP168 has a stronger ability than natural chemical factors to inhibit the entry of HIV-1 (human immunodeficiency virus type 1) into host cells via CXCR4 receptors. RCP168 inhibits HIV-1 infection by blocking viral binding sites or inducing receptor internalization. RCP168 can be used to analyze the interaction between CXCR4 receptor and other chemical factor receptors.
For research use only. We do not sell to patients.
- Formula: C365H585N105O95S5
- Molecular Weight:8124.52
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biological Activity
Description
IC50 & Target
[1]|
CXCR4 5 nM (IC50) |
Chemical Information
-
Molecular Weight 8124.52
-
Formula C365H585N105O95S5
-
Sequence
d-(Leu-Gly-Ala-Ser-Trp-His-Arg-Pro-Asp-Lys)-Cys-Cys-Leu-Gly-Tyr-Gln-Lys-Arg-Pro-Leu-Pro-Gln-Val-Leu-Leu-Ser-Ser-Trp-Tyr-Pro-Thr-Ser-Gln-Leu-Cys-Ser-Lys-Pro-Gly-Val-Ile-Phe-Leu-Thr-Lys-Arg-Gly-Arg-Gln-Val-Cys-Ala-Asp-Lys-Ser-Lys-Asp-Trp-Val-Lys-Lys-Leu-Met-Gln-Gln-Leu-Pro-Val-Thr-Ala-Arg (Disulfide bridge: Cys11-Cys35,Cys12-Cys51)
-
Sequence Shortening
d-(LGASWHRPDK)-CCLGYQKRPLPQVLLSSWYPTSQLCSKPGVIFLTKRGRQVCADKSKDWVKKLMQQLPVTAR (Disulfide bridge: Cys11-Cys35,Cys12-Cys51)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Protocols
-
Research Protocol for Infectious Diseases
Infectious-disease experiments test how pathogens interact with host barriers, innate immune receptors, inflammatory signaling, pathogen replication, and tissue injury; pattern-recognition receptors such as TLRs, RIG-I-like receptors, NOD-like receptors, and inflammasomes detect microbial molecules and activate NF-κB, interferon, and cytokine responses. The central hypothesis is that infection severity reflects the balance between pathogen burden and host response: protective inflammation restricts pathogen growth, whereas excessive or mislocalized inflammation contributes to tissue damage and disease phenotype. Unresolved questions include which host pathways are protective versus pathogenic, why some infection models fail to translate to human disease, and which combined readouts best predict clinically relevant infection outcomes.
-
Cell Cytotoxicity Assay
Cytotoxicity assays are usually based on the assessment of cell membrane damage, which can also be indirectly detected by measuring cell viability. Detection methods include MTT assay, CKK-8 assay, LDH assay and ATP assay, etc.
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)