CTLA-4 Protein, Rat (HEK293, Fc)
Based on 1 Customer Validation
CTLA-4 protein inhibits T-cell responses by binding strongly to CD80 and CD86 receptors, surpassing CD28. This affinity allows CTLA-4 to effectively regulate T-cell activation and immune responses. The balance between inhibitory and stimulatory signals controlled by CTLA-4 and its ligands modulates T-cell-mediated immune reactions. CTLA-4 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CTLA-4 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CTLA-4 protein inhibits T-cell responses by binding strongly to CD80 and CD86 receptors, surpassing CD28. This affinity allows CTLA-4 to effectively regulate T-cell activation and immune responses. The balance between inhibitory and stimulatory signals controlled by CTLA-4 and its ligands modulates T-cell-mediated immune reactions. CTLA-4 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CTLA-4 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
CTLA-4 protein operates as a key inhibitory receptor, serving as a major negative regulator in T-cell responses. Its pivotal role lies in the potent affinity CTLA-4 exhibits for its natural B7 family ligands, CD80 and CD86, a binding strength surpassing that of their counterpart stimulatory coreceptor, CD28. This heightened affinity enables CTLA-4 to effectively temper T-cell activation, forming a crucial component of the regulatory mechanisms governing immune responses. The nuanced balance between inhibitory and stimulatory signals orchestrated by CTLA-4 and its ligands plays a central role in modulating the intensity and duration of T-cell-mediated immune reactions.
Verified Bioactivity
Immobilized Recombinant Rat CD86 / B7-2 Protein (His Tag) at 2 μg/mL (100 μL/well) can bind Recombinant Rat CTLA-4 / CD152 Protein (ECD, Fc Tag) , the EC50 is ≤3.0 ng/mL.
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-hFc
-
Accession
Q62859 (E36-D161)
-
Molecular Construction
-
N-term
-
CTLA-4 (E36-D161)
Accession # Q62859 -
hFc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CTLA4; Celiac Disease 3; Prev. CELIAC3; Cytotoxic T Lymphocyte Associated Antigen 4 Short Spliced Form; Prev. IDDM12; Cytotoxic T-Lymphocyte-Associated Serine Esterase-4; CTLA-4; Cytotoxic T-Lymphocyte-Associated Protein 4; CD152; Cytotoxic T-Lymphocyte Antigen 4; Cytotoxic T-Lymphocyte Protein 4; Alternative Protein CTLA4; GSE; Celiac Disease; CD; CD152 Antigen; Cytotoxic T-Lymphocyte-Associated Antigen 4; ALPS5; Insulin-Dependent Diabetes Mellitus 12; GRD4; Gluten-Sensitive Enteropathy; Cytotoxic T-Lymphocyte Associated Protein 4; Ligand And Transmembrane Spliced Cytotoxic T Lymphocyte Associated Antigen 4
-
AA Sequence
EAIQVTQPSVVLASSHGVASFPCEYASSHNTDEVRVTVLRQTNDQVTEVCATTFTVKNTLGFLDDPFCSGTFNESRVNLTIQGLRAADTGLYFCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD
-
Predicted Molecular Mass
40.5 kDa
-
Molecular Weight
Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
