IFN-gamma Protein, Human
Based on 85 publication(s) in Google Scholar
IFN-gamma Protein, human activates STAT signaling pathway and affects gene regulation. IFN-gamma Protein, human activates effector immune cells and enhances antigen presentation. IFN-gamma Protein, human also regulates the hematopoietic stem cells development. IFN-gamma Protein, human is the recombinant human-derived IFN-gamma Protein, expressed by E. coli.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IFN-gamma Protein, human activates STAT signaling pathway and affects gene regulation. IFN-gamma Protein, human activates effector immune cells and enhances antigen presentation. IFN-gamma Protein, human also regulates the hematopoietic stem cells development. IFN-gamma Protein, human is the recombinant human-derived IFN-gamma Protein, expressed by E. coli.
Background
Human Interferon-gamma (hIFNγ) is naturally produced by CD4+ T helper cell type 1 (Th1) lymphocytes, CD8+ cytotoxic lymphocytes, natural killer (NK) cells, B cells, NKT cells, and professional antigen-presenting cells (APCs). Secretion of hIFNγ by NK cells and APCs is important in early host reactions against infection while production of hIFNγ by T lymphocytes is important in the adaptive immune response. hIFNγ shows antiviral and antitumor activity and is involved in complex interactions of cellular metabolism and differentiation[1]. Interferon-gamma (IFN-γ) is a cytokine with potent immunomodulatory propertiy. IFN-γ activates cells via a different receptor than IFN-α and IFN-β, which accounts for the different physiological properties of the proteins[2].
In Vitro
IFN-gamma Protein (human, 0-1000 ng/mL, 12-18 h) induces IFN-γ-inducible protein-16 (IFI16) accumulation in A549 nucleus and cytoplasm[3].
IFN-gamma Protein (human, 100 ng/mL, 24 h) promotes the PD-L1 expression, activates PI3K/Akt and ERK1/2 signaling pathways, increases the CD44+/CD24- cell ratio, and enhances cell sphere formation ability. IFN-gamma Protein promotes the stemness of breast cancer cell MCF-7[4].
Verified Bioactivity
The ED50 is <1 ng/mL as measured by its ability to inhibit the proliferation of HT-29 cells, corresponding to a specific activity of >1 × 106 units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Publications (85)
-
Journal Impact Factor
-
Most Recent
-
Cancer Cell
2025 Dec 8;43(12):2282-2297.e9. PMID: 41202810 -
Immunity
Spatiotemporal dynamics of CXCL10 encode contextual immune information revealed by the genetically encoded fluorescent sensor. [Abstract]2025 Sep 9;58(9):2320-2335.e9. PMID: 40818452 -
Cancer Res
2025 Nov 11. PMID: 41218148
IFN-gamma Protein, Human purchased from MedChemExpress. Usage Cited in: Cancer Res. 2025 Nov 11. [Abstract]
Flow cytometry was used to assess the surface expression levels of MHC-I in MDA-MB-468 under different TSPAN13 expression levels, with or without IFNγ (30 ng/mL, 24 h) stimulation.
-
Nat Microbiol
IFI16 directly senses viral RNA and enhances RIG-I transcription and activation to restrict influenza virus infection. [Abstract]2021 Jul;6(7):932-945. PMID: 33986530
IFN-gamma Protein, Human purchased from MedChemExpress. Usage Cited in: Nat Microbiol. 2021 Jul;6(7):932-945. [Abstract]
IFI16 expression in A549 cells treated with IFN-γ (50, 500, 1000 ng/mL) for 18 h was determined.
IFN-gamma Protein, Human purchased from MedChemExpress. Usage Cited in: Nat Microbiol. 2021 Jul;6(7):932-945. [Abstract]
Intracellular localization of IFI16 in A549 cells treated with poly(I:C) or IFN-γ (500 ng/mL) for 12 h was determined.
-
Nat Commun
Antigen-presenting cancer associated fibroblasts enhance antitumor immunity and predict immunotherapy response. [Abstract]2025 Mar 4;16(1):2175. PMID: 40038297 -
Redox Biol
Accumulated cholesterol protects tumours from elevated lipid peroxidation in the microenvironment. [Abstract]2023 Jun:62:102678. PMID: 36940607 -
J Nanobiotechnology
Nitric oxide-releasing nanocarriers integrated with ginsenoside compound K in dissolvable microneedles for androgenetic alopecia. [Abstract]2025 Dec 20. PMID: 41422253 -
Theranostics
C-terminal Fragment Generated by HOIL-1 Cleavage Suppresses Inflammatory Responses of Myeloid Cells to Alleviate Colitis. [Abstract]2026 Feb 11;16(9):4580-4602. PMID: 41799187 -
Theranostics
Nintedanib enhances the efficacy of PD-L1 blockade by upregulating MHC-I and PD-L1 expression in tumor cells. [Abstract]2022 Jan 1;12(2):747-766. PMID: 34976211
IFN-gamma Protein, Human purchased from MedChemExpress. Usage Cited in: Theranostics. 2022 Jan 1;12(2):747-766. [Abstract]
Protein expression levels of TAP1, PD-L1 and β2M after nintedanib combined with IFN-γ (10 ng/mL, 24 h) treated.
IFN-gamma Protein, Human purchased from MedChemExpress. Usage Cited in: Theranostics. 2022 Jan 1;12(2):747-766. [Abstract]
The regulation of STM2457 on the total expression of PD-L1 protein was detected using Western blot in A549 and H1975 cells treated with STM2457 (0, 0.05, 0.5, 5, and 50 mM) with interferon-gamma (IFN-g) induction (10 ng/mL) for 24 h.
-
Adv Sci (Weinh)
Deciphering the Role and Mechanism of Decidual Monocyte-Derived Macrophage Infiltration in Obstetric Antiphospholipid Syndrome at Single-Cell Resolution. [Abstract]2025 Aug 7:e03480. PMID: 40776470 -
Cell Rep Med
2025 Aug 19;6(8):102257. PMID: 40744022 -
Biomaterials
In silico optimized cell-penetrating peptides achieve transdermal siRNA delivery and regulate inflammatory environment in psoriasis. [Abstract]2026 May:328:123882. PMID: 41343908 -
-
J Control Release
Inflammation-targeted nanoparticles modulate macrophage polarization for coronary therapy in Kawasaki disease. [Abstract]2025 Oct 22;388(Pt 2):114350. PMID: 41135700 -
Cell Death Dis
Downregulation of N6-methyladenosine-modified LINC00641 promotes EMT, but provides a ferroptotic vulnerability in lung cancer. [Abstract]2023 Jun 13;14(6):359. PMID: 37311754 -
Cancer Lett
Targeting C/EBPβ/SCD1/C16:1 loop-driven macrophage M2 polarization by Bruceine D improves anti-PD-1 immunotherapy in colorectal cancer. [Abstract]2026 Sep 28:656:218655. PMID: 42250753 -
Cancer Lett
Acidosis activates breast cancer ferroptosis through ZFAND5/SLC3A2 signaling axis and elicits M1 macrophage polarization. [Abstract]2024 Apr 10:587:216732. PMID: 38360142 -
Biosens Bioelectron
A CRISPR-derived biosensor for the sensitive detection of transcription factors based on the target-induced inhibition of Cas12a activation. [Abstract]2021 Feb 1:173:112619. PMID: 33221511 -
J Allergy Clin Immunol
Cigarette smoke-induced epithelial cell ferroptosis promotes neutrophilic inflammation in patients with nasal polyps. [Abstract]2025 Jun;155(6):1882-1897. PMID: 40086488 -
Phytomedicine
Bruceine A ameliorates ulcerative colitis via macrophage polarization: Targeting HSP90-mediated IL-17 signaling and NF-κB activation. [Abstract]2025 Nov:147:157200. PMID: 40907407 -
Phytomedicine
2025 Apr:139:156563. PMID: 40023068 -
-
J Pharm Anal
Effects and translatomics characteristics of a small-molecule inhibitor of METTL3 against non-small cell lung cancer. [Abstract]2023 Jun;13(6):625-639. PMID: 37440912 -
EBioMedicine
2019 Mar:41:395-407. PMID: 30803931 -
Nano Today
Reprogramming the pancreatic cancer stroma and immune landscape by a silicasome nanocarrier delivering nintedanib, a protein tyrosine kinase inhibitor. [Abstract]2024 Feb:54:102058. PMID: 38681872 -
-
Chin Med J (Engl)
IRAK1 promotes gastric cancer progression by activating the PI3K/AKT/mTOR pathway and inducing the M2 polarization of tumor-associated macrophages. [Abstract]2025 Dec 19. PMID: 41424035 -
Apoptosis
Deciphering macrophage heterogeneity and factors driving M2 polarization in lung adenocarcinoma through single-cell RNA sequencing. [Abstract]2025 Oct 16. PMID: 41099999 -
Food Res Int
Fermentation enhances the amelioration effect of bee pollen on Caco-2 monolayer epithelial barrier dysfunction based on NF-κB-mediated MLCK-MLC signaling pathway. [Abstract]2024 Feb:178:113938. PMID: 38309866 -
Int J Biol Macromol
Purification and structural characterization of two polysaccharides with anti-inflammatory activities from Plumbago zeylanica L. [Abstract]2024 Mar;260(Pt 1):129455. PMID: 38232876 -
Int J Biol Macromol
Polysaccharide from Strongylocentrotus nudus eggs regulates intestinal epithelial autophagy through CD36/PI3K-Akt pathway to ameliorate inflammatory bowel disease. [Abstract]2023 Jul 31:244:125373. PMID: 37327932 -
Antioxidants (Basel)
Alpha-Lipoic Acid Inhibits IFN-γ-Induced PD-L1 Expression in Prostate Cancer Cells and Enhances T-Cell-Mediated Anti-Tumor Cytotoxicity. [Abstract]2026 Mar 25;15(4):413. PMID: 42072056 -
Free Radic Biol Med
p67phox/NOX2 inhibits psoriasis by regulating the HIF-1α-glycolysis axis via p53-AMPK in keratinocytes. [Abstract]2025 Sep:237:503-514. PMID: 40516795 -
Stem Cell Res Ther
Induced pluripotent stem cell-derived mesenchymal stem cells (iMSCs) inhibit M1 macrophage polarization and reduce alveolar bone loss associated with periodontitis. [Abstract]2025 May 2;16(1):223. PMID: 40317064 -
Front Immunol
Adipose-Derived Mesenchymal Stem Cells Reprogram M1 Macrophage Metabolism via PHD2/HIF-1α Pathway in Colitis Mice. [Abstract]2022 Jun 10;13:859806. PMID: 35757749 -
J Agric Food Chem
Early-Life Intervention with Bifidobacterium longum subsp. infantis CCFM1269 Alleviates Atopic Dermatitis in Mice via the Indole-3-Lactic Acid-AHR Signaling Pathway. [Abstract]2026 Aug 5;74(30):23495-23508. PMID: 42479854 -
J Agric Food Chem
6,7-Dihydroxy-2,4-Dimethoxyphenanthrene from Chinese Yam Peels Alleviates DSS-Induced Intestinal Mucosal Injury in Mice via Modulation of the NF-κB/COX-2 Signaling Pathway. [Abstract]2021 Apr 28;69(16):4720-4731. PMID: 33760601 -
Cell Biosci
Differential effects of PGAM5 knockout on high fat high fructose diet and methionine choline-deficient diet induced non-alcoholic steatohepatitis (NASH) in mice. [Abstract]2023 Aug 21;13(1):154. PMID: 37605246 -
Liver Int
Targeting RNA Polymerase I Inhibits Ribosome Biogenesis to Block Liver Fibrosis Progression. [Abstract]2026 Jan;46(1):e70478. PMID: 41388799 -
Inflamm Res
Aldosterone induces renal lymphangiogenesis through macrophage-lymphatic endothelial cell transformation and Inhibition by esaxerenone. [Abstract]2025 May 24;74(1):85. PMID: 40413281 -
Anal Chim Acta
An exonuclease protection and CRISPR/Cas12a integrated biosensor for the turn-on detection of transcription factors in cancer cells. [Abstract]2021 Jun 22:1165:338478. PMID: 33975701 -
Cells
TcpC Inhibits M1 but Promotes M2 Macrophage Polarization via Regulation of the MAPK/NF-κB and Akt/STAT6 Pathways in Urinary Tract Infection. [Abstract]2022 Aug 28;11(17):2674. PMID: 36078080 -
Colloids Surf B Biointerfaces
Keratinocyte membrane-coated nanoparticle combined with epidermal-targeted microneedle for targeted therapy of atopic dermatitis. [Abstract]2026 Mar 25:264:115653. PMID: 41921409 -
Stem Cells Transl Med
Mixed lymphocyte reaction-conditioned MSC-derived extracellular vesicles enhance graft survival via miR-638-mediated immunoregulation. [Abstract]2025 Apr 22;14(4):szaf009. PMID: 40261200 -
Eur J Pharmacol
2022 Apr 5:920:174822. PMID: 35151642 -
Int Immunopharmacol
Electroacupuncture protects intestinal barrier integrity in MAFLD mice and is associated with a macrophage α7nAChR/exosomal miR-217-5p/epithelial HO-1 signaling axis. [Abstract]2026 Aug 15:183:116879. PMID: 42161050 -
Int J Mol Sci
Esaxerenone Attenuates Aldosterone-Induced Renal Fibrosis by Suppressing Fibroblast-to-Lymphatic Endothelial-like Cell Transdifferentiation. [Abstract]2026 May 12;27(10):4297. PMID: 42196278 -
Int J Mol Sci
Elucidating the Mechanisms of Chrysanthemum Action on Atopic Dermatitis via Network Pharmacology and Machine Learning. [Abstract]2025 Nov 21;26(23):11262. PMID: 41373428 -
Int Immunopharmacol
Nicotinamide mononucleotide ameliorates hypertriglyceridemia pancreatitis via NAD+/SIRT1-mediated TXNIP suppression and NOTCH pathway for accelerated repair-associated processes. [Abstract]2025 May 16:155:114620. PMID: 40215777 -
Int Immunopharmacol
NOX2 deficiency promotes GSDME-related pyroptosis by reducing AMPK activation in neutrophils. [Abstract]2024 Oct 29;143(Pt 2):113504. PMID: 39476568 -
Int Immunopharmacol
Chinese medicine compound prescription HeQi San ameliorates chronic inflammatory states and modulates gut flora in dehydroepiandrosterone-induced polycystic ovary syndrome mouse model. [Abstract]2024 Aug 20:137:112491. PMID: 38909499 -
Int Immunopharmacol
Hsa_circRNA_103124 upregulation in Crohn's disease promoted macrophage M1 polarization to maintain an inflammatory microenvironment via activation of the AKT2 and TLR4/NF-κB pathways. [Abstract]2023 Oct:123:110763. PMID: 37567009 -
Invest Ophthalmol Vis Sci
Adalimumab Reprograms M1 Macrophages to Attenuate Th1/Th17 Responses in Behçet's Uveitis and Vogt-Koyanagi-Harada Syndrome. [Abstract]2026 Jun 1;67(6):4. PMID: 42227805 -
Biol Direct
Prognostic and immunological implications of protein kinases in gastric cancer: a focus on hub gene ABL2 and its impact on the polarization of M2 macrophages. [Abstract]2025 Mar 24;20(1):35. PMID: 40128818 -
Front Cell Dev Biol
Enhancing Fatty Acid Catabolism of Macrophages Within Aberrant Breast Cancer Tumor Microenvironment Can Re-establish Antitumor Function. [Abstract]2021 Apr 15:9:665869. PMID: 33937269 -
Sci Rep
Integrated network pharmacology, transcriptomics, and experimental validation to explore the mechanism of Qihuang Jianpi Zishen granules against Sjögren's syndrome. [Abstract]2025 Jul 1;15(1):21176. PMID: 40593998 -
Eur J Med Res
GDF-15 upregulates the SLC7A11/GPX4 signaling axis and promotes mitoxantrone resistance in AML cells. [Abstract]2025 Jun 21;30(1):504. PMID: 40544302 -
Cell Signal
N-α-Acetyltransferase 40 promotes oral squamous cell carcinoma progression by enhancing FEN1 transcription and suppressing CD8+ T cell antitumor immunity. [Abstract]2026 Mar:139:112335. PMID: 41423010 -
Mol Cell Biochem
Nitric oxide induces apoptosis of human primary melanocytes by regulating calcium homeostasis via VDAC1. [Abstract]2025 Aug 3. PMID: 40753527 -
J Cell Mol Med
MTHFD2 promotes PD-L1 expression via activation of the JAK/STAT signalling pathway in bladder cancer. [Abstract]2023 Oct;27(19):2922-2936. PMID: 37480214 -
J Inflamm Res
M1-Type Macrophages Secrete TNF-α to Stimulate Vascular Calcification by Upregulating CA1 and CA2 Expression in VSMCs. [Abstract]2023 Jul 19;16:3019-3032. PMID: 37489150 -
-
J Trace Elem Med Biol
Iron dysregulation and ferroptosis are associated with pulmonary fibrosis: Insight from idiopathic pulmonary fibrosis, systemic sclerosis, and COVID-19 patients. [Abstract]2025 Oct:91:127728. PMID: 40857901 -
J Pathol Clin Res
Platinum drugs upregulate CXCR4 and PD-L1 expression via ROS-dependent pathways, with implications for novel combined treatment in gastric cancer. [Abstract]2025 Jan;11(1):e70015. PMID: 39870588 -
Reprod Biomed Online
miR-21-5p-loaded bone mesenchymal stem cell-derived exosomes repair ovarian function in autoimmune premature ovarian insufficiency by targeting MSX1. [Abstract]2024 Jun;48(6):103815. PMID: 38582043 -
Reprod Biomed Online
Exosomes derived from mesenchymal stem cells attenuate NLRP3-related pyroptosis in autoimmune premature ovarian insufficiency via the NF-κB pathway. [Abstract]2024 Jun;48(6):103814. PMID: 38569224 -
-
Exp Cell Res
Pseudane V alleviates ox-LDL-induced macrophage M1 polarization by inhibiting m6A modification of PPARGC1A. [Abstract]2025 Nov 25;454(2):114842. PMID: 41297622 -
-
PeerJ
FGF19 promotes cell autophagy and cisplatin chemoresistance by activating MAPK signaling in ovarian cancer. [Abstract]2023 Feb 2:11:e14827. PMID: 36751636 -
Curr Microbiol
2025 Dec 27;83(2):100. PMID: 41460255 -
PLoS One
Effect of the TIM-3/Gal-9 signaling pathway on macrophage polarization in peri-implantitis. [Abstract]2025 Jul 18;20(7):e0328258. PMID: 40679998 -
Biomol Biomed
Periplocin improves the sensitivity of oxaliplatin-resistant hepatocellular carcinoma cells by inhibiting M2 macrophage polarization. [Abstract]2025 Mar 7;25(4):857-868. PMID: 39207178 -
Biochem Biophys Res Commun
Knockdown of long non-coding RNA BISPR attenuates the proinflammatory cytokine IL-6 production in human microglia. [Abstract]2025 Dec 31:793:153011. PMID: 41275794 -
Arch Dermatol Res
Icariin ameliorates TNF-α/IFN-γ-induced oxidative stress, inflammatory response and apoptosis of human immortalized epidermal cells through the WTAP/SERPINB4 axis. [Abstract]2024 Aug 23;316(8):557. PMID: 39177922 -
Hum Immunol
Gpx1 induces M2 polarization of macrophages, contributing to doxorubicin resistance in triple-negative breast cancer. [Abstract]2025 Aug 19;86(5):111566. PMID: 40834701 -
In Vitro Cell Dev Biol Anim
PKCβ expression contributes to M1 macrophage-induced impairment in the osteogenic differentiation of periodontal ligament stem cells. [Abstract]2025 Jun;61(6):635-643. PMID: 40526258 -
Eur J Histochem
Knockdown of miR-411-3p induces M2 macrophage polarization and promotes colorectal cancer progression by regulation of MMP7. [Abstract]2025 Apr 7;69(2). PMID: 40322788 -
J Environ Sci (China)
Nanoplastics and triclosan co-exposure aggravates DSS-induced colitis in mice by interfering with Akkermansia muciniphila and tryptophan metabolism. [Abstract]2026 Mar:161:189-200. PMID: 41461466 -
-
bioRxiv
RHOA Loss of Function Impairs the IFNγ Response and Promotes CD19 Antigen Escape to Drive CAR-T Resistance in Diffuse Large B-cell Lymphoma. [Abstract]2025 Mar 4:2025.02.27.640687. PMID: 40093149 -
-
-
-
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P01579 (Q24-Q166)
-
Molecular Construction
-
N-term
-
IFN-gamma (Q24-Q166)
Accession # P01579 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IFNG; IMD69; Interferon Gamma; IFG; IFN-Gamma; IFI; Immune Interferon
-
AA Sequence
QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
-
Predicted Molecular Mass
16.7 kDa
-
Molecular Weight
Approximately 16-17 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of PBS, 5 % trehalose, 5% mannitol, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, 5% trehalose, 5% mannitol, pH 7.4.
4.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Razaghi A, et al. Review of the recombinant human interferon gamma as an immunotherapeutic: Impacts of production platforms and glycosylation. J Biotechnol. 2016 Dec 20;240:48-60. [Content Brief]
[2]. Fam CM, et al. PEGylation improves the pharmacokinetic properties and ability of interferon gamma to inhibit growth of a human tumor xenograft in athymic mice. J Interferon Cytokine Res. 2014 Oct;34(10):759-68. [Content Brief]
[3]. Jiang Z, et al., IFI16 directly senses viral RNA and enhances RIG-I transcription and activation to restrict influenza virus infection. Nat Microbiol. 2021 Jul;6(7):932-945. [Content Brief]
[4]. Gao L, et al., MiR-873/PD-L1 axis regulates the stemness of breast cancer cells. EBioMedicine. 2019 Mar;41:395-407. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)