SDF-1α (human) TFA
Based on 2 publication(s) in Google Scholar
SDF-1α (human) TFA is a mononuclear cells chemoattractant that can bind to CXCR4. SDF-1α plays a central role in stem cell homing, retention, survival, proliferation, cardiomyocyte repair, angiogenesis and ventricular remodelling following myocardial infarction. SDF-1α (human) TFA can be used in cardiovascular disease research.
For research use only. We do not sell to patients.
- Purity: 98.89%
- Formula: C356H578N106O93S4.xC2HF3O2
- Molecular Weight:7959.34 (free acid)
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications Citing Use of MedChemExpress (MCE) SDF-1α (human) TFA
More
Biological Activity
Description
Chemical Information
-
Appearance Solid
-
Molecular Weight 7959.34 (free acid)
-
Formula C356H578N106O93S4.xC2HF3O2
-
Color White to off-white
-
Sequence
Lys-Pro-Val-Ser-Leu-Ser-Tyr-Arg-Cys-Pro-Cys-Arg-Phe-Phe-Glu-Ser-His-Val-Ala-Arg-Ala-Asn-Val-Lys-His-Leu-Lys-Ile-Leu-Asn-Thr-Pro-Asn-Cys-Ala-Leu-Gln-Ile-Val-Ala-Arg-Leu-Lys-Asn-Asn-Asn-Arg-Gln-Val-Cys-Ile-Asp-Pro-Lys-Leu-Lys-Trp-Ile-Gln-Glu-Tyr-Leu-Glu-Lys-Ala-Leu-Asn-Lys (Disulfide bridge:Cys9-Cys34;Cys11-Cys50)
-
Sequence Shortening
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK (Disulfide bridge:Cys9-Cys34;Cys11-Cys50)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
-
ACS Appl Mater Interfaces
Advanced Strategies in Bone Tissue Engineering: "Membrane-Jelly" Hydrogel System to Improve Bone Marrow Stem Cell Osteogenic Differentiation and Bone Regeneration. [Abstract]2025 Jun 18;17(24):34982-34996. PMID: 40492576
Solvent & Solubility
In Vitro:
DMSO : 100 mg/mL (Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Purity & Documentation
-
Data Sheet (307 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Gupta SK, et al. Modulation of CXCR4 expression and SDF-1alpha functional activity during differentiation of human monocytes and macrophages. J Leukoc Biol. 1999 Jul;66(1):135-43. [Content Brief]
[2]. Bromage DI, et al. Stromal derived factor 1α: a chemokine that delivers a two-pronged defence of the myocardium. Pharmacol Ther. 2014 Sep;143(3):305-15. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)