SDF-1α (human)
Based on 2 publication(s) in Google Scholar
SDF-1α (human) is a mononuclear cells chemoattractant that can bind to CXCR4. SDF-1α plays a central role in stem cell homing, retention, survival, proliferation, cardiomyocyte repair, angiogenesis and ventricular remodelling following myocardial infarction. SDF-1α (human) can be used in cardiovascular disease research.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- CAS. Nr.: 1268129-65-2
- Formel: C356H578N106O93S4
- Molecular Weight:7959.34
-
Speicherung:
Please store the product under the recommended conditions in the Certificate of Analysis.
Publications Citing Use of MedChemExpress (MCE) SDF-1α (human)
More
Biologische Aktivität
Chemical Information
-
CAS. Nr. 1268129-65-2
-
Molecular Weight 7959.34
-
Formel C356H578N106O93S4
-
Sequence
Lys-Pro-Val-Ser-Leu-Ser-Tyr-Arg-Cys-Pro-Cys-Arg-Phe-Phe-Glu-Ser-His-Val-Ala-Arg-Ala-Asn-Val-Lys-His-Leu-Lys-Ile-Leu-Asn-Thr-Pro-Asn-Cys-Ala-Leu-Gln-Ile-Val-Ala-Arg-Leu-Lys-Asn-Asn-Asn-Arg-Gln-Val-Cys-Ile-Asp-Pro-Lys-Leu-Lys-Trp-Ile-Gln-Glu-Tyr-Leu-Glu-Lys-Ala-Leu-Asn-Lys (Disulfide bridge:Cys9-Cys34;Cys11-Cys50)
-
Sequence Shortening
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK (Disulfide bridge:Cys9-Cys34;Cys11-Cys50)
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Please store the product under the recommended conditions in the Certificate of Analysis.
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
-
ACS Appl Mater Interfaces
Advanced Strategies in Bone Tissue Engineering: "Membrane-Jelly" Hydrogel System to Improve Bone Marrow Stem Cell Osteogenic Differentiation and Bone Regeneration. [Abstract]2025 Jun 18;17(24):34982-34996. PMID: 40492576
Reinheit & Dokumentation
Verweise
[1]. Gupta SK, et al. Modulation of CXCR4 expression and SDF-1alpha functional activity during differentiation of human monocytes and macrophages. J Leukoc Biol. 1999 Jul;66(1):135-43. [Content Brief]
[2]. Bromage DI, et al. Stromal derived factor 1α: a chemokine that delivers a two-pronged defence of the myocardium. Pharmacol Ther. 2014 Sep;143(3):305-15. [Content Brief]
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)