2. Anti-infection
  3. Antibiotic
  4. BMAP-28

BMAP-28 is an antibiotic peptide and an inducer of the mitochondrial permeability transition pore. BMAP-28 induces cell death through opening of the mitochondrial permeability transition pore. BMAP-28 can be used in study of microbial infections and cancer.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

BMAP-28 Chemical Structure

BMAP-28 Chemical Structure

CAS No. : 184870-31-3

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

BMAP-28 Related Antibodies

Top Publications Citing Use of Products

View All Antibiotic Isoform Specific Products:

View All Isoforms

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

BMAP-28 is an antibiotic peptide and an inducer of the mitochondrial permeability transition pore. BMAP-28 induces cell death through opening of the mitochondrial permeability transition pore. BMAP-28 can be used in study of microbial infections and cancer[1].

In Vitro

BMAP-28 (3 µM; 10 min) attenuates mitochondrial calcein fluorescence in U937 cells[1].
BMAP-28 causes depolarization of the inner mitochondrial membrane in single cells and in isolated mitochondria[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

BMAP-28 Related Antibodies

Immunofluorescence[1]

Cell Line: U937 cells
Concentration: 3 µM
Incubation Time: 10 min
Result: Caused a remarkable attenuation of the calcein fluorescence.
Molecular Weight

3073.81

Formula

C145H250N44O29
CAS No.
Sequence

Gly-Gly-Leu-Arg-Ser-Leu-Gly-Arg-Lys-Ile-Leu-Arg-Ala-Trp-Lys-Lys-Tyr-Gly-Pro-Ile-Ile-Val-Pro-Ile-Ile-Arg-Ile-NH2
Sequence Shortening

GGLRSLGRKILRAWKKYGPIIVPIIRI-NH2
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

BMAP-28 Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

BMAP-28184870-31-3BMAP28BMAP 28AntibioticU937 cellsmitochondriacancerinfectionpeptideInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BMAP-28
Cat. No.:
HY-P5288
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.