Met-RANTES (human)

(Synonyms: MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN)

Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA).

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

  • CAS No.: 1883816-50-9
  • Formule: C355H543N97O101S6
  • Masse moléculaire:7978.07
  • Stockage:

    Please store the product under the recommended conditions in the Certificate of Analysis.

  • Activité biologique
  • Chemical Information
  • Pureté et documentation
  • Références
  • Help & FAQs

Voir tous les produits spécifiques à Isoform CCR

More
MOQ
Minimum order quantity
100 mg

Obtenir un devis En stock

Other size
Obtenir un devis
Please select quantity
Amount: USD 0.00