Met-RANTES (human)

(Synonyms: MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN)

Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA).

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.

  • CAS. Nr.: 1883816-50-9
  • Formel: C355H543N97O101S6
  • Molecular Weight:7978.07
  • Speicherung:

    Please store the product under the recommended conditions in the Certificate of Analysis.

  • Biologische Aktivität
  • Chemical Information
  • Reinheit & Dokumentation
  • Verweise
  • Help & FAQs

Alle CCR Isoform-spezifische Produkte anzeigen

More
MOQ
Minimum order quantity
100 mg

Angebot einholen Auf Lager

Other size
Angebot einholen
Please select quantity
Amount: USD 0.00