country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Country or Region:

United States

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P0276A

Copy Link Print Information

GIP, human TFA

Name: GIP, human TFA
Brand: MedChemExpress
SKU: HY-P0276A
Price: 500.00 USD
Availability: InStock
Rating: 5 (3 reviews)

(Synonyms: Gastric Inhibitory Peptide (GIP), human TFA)

3 Cited Publications

고객리뷰

Based on 3 publication(s) in Google Scholar

GIP, human TFA, a peptide hormone consisting of 42 amino acids, is a stimulator of glucose-dependent insulin secretion and a weak inhibitor of gastric acid secretion. GIP, human TFA acts as an incretin hormone released from intestinal K cells in response to nutrient ingestion.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Purity : 99.15%
화학식: C₂₂₆H₃₃₈N₆₀O₆₆S.xC₂HF₃O₂
분자량:4983.53 (free base)

보관:

Sealed storage, away from moisture and light, under nitrogen.

Powder -80°C, 2 years , -20°C, 1 year

* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

GIP, human TFA Chemical Structure

사이즈

가격

재고

수량

Amount: USD 0.00

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity
- 제품 설명
- In Vitro
Chemical Information
Publications (3)
용액&용해도
- In Vitro
Protocol (2)
순도&문서
References
Calculators
Help & FAQs
Classifications
Bioz

Biological Activity

제품 설명

In Vitro

Gastric Inhibitory Polypeptide (GIP) exerts various peripheral effects on adipose tissue and lipid metabolism, thereby leading to increased lipid deposition in the postprandial state^[1]. GIP, human plays a vital role in lipid metabolism and the development of obesity.

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. Further protocols information, click here.

Chemical Information

Appearance Solid
분자량 4983.53 (free base)
화학식 C₂₂₆H₃₃₈N₆₀O₆₆S.xC₂HF₃O₂
Color White to off-white
Synonyms

Gastric Inhibitory Peptide (GIP), human TFA
Sequence

Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln
Sequence Shortening

YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
선적

Room temperature in continental US; may vary elsewhere.

보관

Sealed storage, away from moisture and light, under nitrogen

Powder	-80°C	2 years
	-20°C	1 year

* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Publications (3)

All Histological Imaging/StainingELISACell Proliferation/Viability AssayFlow CytometryIF

Sort by:

Journal Impact Factor

Toxins

Deoxynivalenol (Vomitoxin)-Induced Anorexia Is Induced by the Release of Intestinal Hormones in Mice. [Abstract]

2021 Jul 22;13(8):512. PMID: 34437383
Gynecol Endocrinol

Glucose-dependent insulinotropic peptide (GIP) suppresses androgen biosynthesis in PCOS mouse models and cellular systems. [Abstract]

2025 Dec 31;41(1):2582506. PMID: 41249890

GIP, human TFA purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506. [Abstract]

GIP (0.1 mg/kg, a single subcutaneous injection) inhibited large cystic follicles and fewer granular cell layers in DHEA (50 mg/kg, subcutaneous injection for 21 days) induced-PCOS C57BL/6J mice (Left: Normal control; Middle: PCOS model (vehicle); Right: PCOS model + GIP).

GIP, human TFA purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506. [Abstract]

GIP（ 0.1 mg/kg，a single subcutaneous injection） reduced the serum testosterone concentration in DHEA (50 mg/kg,subcutaneous injection for 21 days）induced-PCOS C57BL/6J mice.

GIP, human TFA purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506. [Abstract]

GIP (10^-7 and 10^-9 M, 6, 12, and 24 h) had no effect on growth in NCI-H295R cells.

GIP, human TFA purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506. [Abstract]

GIP (10^-9 M, 24 h) did not induce apoptosis in NCI-H295R cells.

GIP, human TFA purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506. [Abstract]

GIP (10-9 M, 24 h) downregulated GIPR expression in NCI-H295R cells.
bioRxiv

2026 Jul 23.

용액&용해도

In Vitro:

DMSO : ≥ 100 mg/mL

H₂O : 10 mg/mL (Need ultrasonic)

* "≥" means soluble, but saturation unknown.

View the Complete Stock Solution Preparation Table

Protocol

All Signal Pathway Related Cell Biology

Research Protocol for Endocrine Diseases
Endocrine diseases often arise from disrupted hormone production, hormone signaling, or target-tissue responsiveness; for diabetes-focused endocrine disease models, insulin signaling regulates glucose uptake, hepatic glucose output, lipid metabolism, and β-cell compensation. Type 2 diabetes develops through interacting defects in insulin resistance, β-cell dysfunction, adipose inflammation, hepatic glucose overproduction, altered incretin signaling, and ectopic lipid metabolism. A major unresolved question is whether endocrine dysfunction is driven primarily by target-tissue insulin resistance, intrinsic β-cell failure, immune/inflammatory stress, or combined multi-organ failure that differs by disease stage.
Human Islet Cell Culture
The method of preserving islets in vitro, with purified reduced immunogenicity. The steps are islet isolation, islet cell purification, in vitro determination of islet function and islet cell culture.

순도&문서

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (287 KB)
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. Meier JJ, et al. Gastric inhibitory polypeptide: the neglected incretin revisited. Regul Pept. 2002 Jul 15;107(1-3):1-13. [Content Brief]

[2]. Miyachi A, et al. Quantitative analytical method for determining the levels of gastric inhibitory polypeptides GIP1-42 and GIP3-42 in human plasma using LC-MS/MS/MS. J Proteome Res. 2013;12(6):2690-2699. [Content Brief]

[3]. Gabe MBN, et al. Molecular interactions of full-length and truncated GIP peptides with the GIP receptor - A comprehensive review. Peptides. 2020;125:170224. [Content Brief]

Calculators

몰농도 계산기

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

농도 희석 계산기

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Bioz

Keywords

GIP, human TFA

3 Cited Publications

100 mg 견적 받기

Subscribe to the

MedChemExpress

Newsletter

MOQ

Minimum order quantity

100 mg

견적 받기 해외재고보유

Other size

견적 받기

Amount: USD 0.00

Biological Activity
- 제품 설명
- In Vitro
Chemical Information
Publications (3)
용액&용해도
- In Vitro
Protocol
순도&문서
References

1/16
1/16

GIP, human TFA purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506. [Abstract]

Customer Validation
GIP (0.1 mg/kg, a single subcutaneous injection) inhibited large cystic follicles and fewer granular cell layers in DHEA (50 mg/kg, subcutaneous injection for 21 days) induced-PCOS C57BL/6J mice (Left: Normal control; Middle: PCOS model (vehicle); Right: PCOS model + GIP).
1/16

GIP, human TFA purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506. [Abstract]

Customer Validation
GIP（ 0.1 mg/kg，a single subcutaneous injection） reduced the serum testosterone concentration in DHEA (50 mg/kg,subcutaneous injection for 21 days）induced-PCOS C57BL/6J mice.
1/16

GIP, human TFA purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506. [Abstract]

Customer Validation
GIP (10^-7 and 10^-9 M, 6, 12, and 24 h) had no effect on growth in NCI-H295R cells.
1/16

GIP, human TFA purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506. [Abstract]

Customer Validation
GIP (10^-9 M, 24 h) did not induce apoptosis in NCI-H295R cells.
1/16

GIP, human TFA purchased from MedChemExpress. Usage Cited in: Gynecol Endocrinol. 2025 Dec 31;41(1):2582506. [Abstract]

Customer Validation
GIP (10-9 M, 24 h) downregulated GIPR expression in NCI-H295R cells.

상품명:
Cat. No.:
수량:
MCE Japan Authorized Agent:

상품명:
CAS No.:
Species:
Purity:
수량:

GIP, human TFA

Publications Citing Use of MedChemExpress (MCE) GIP, human TFA