Search Result

Results for "

Lewis

" in MedChemExpress (MCE) Product Catalog:

By Targets:	Akt (5) Antibiotic (2) Apoptosis (14) Arp2/3 Complex (2) ASK1 (1) Bacterial (1) Bcl-2 Family (6) Biochemical Assay Reagents (19) Bradykinin Receptor (1) c-Fms (2) c-Myc (1) Cadherin (1) Calmodulin (1) Caspase (8) CCR (2) CD3 (1) CDK (1) Choline Kinase (1) COX (1) Cyclin G-associated Kinase (GAK) (1) Cytochrome P450 (1) DNA/RNA Synthesis (4) Dopamine Transporter (1) Drug Derivative (4) Drug Intermediate (3) Drug Isomer (1) E-Selectin (1) EGFR (1) Endogenous Metabolite (11) ERK (1) FAK (1) Ferroportin (1) FGFR (2) Fluorescent Dye (3) Fungal (1) Galectin (2) Glucocorticoid Receptor (2) Glucosylceramide Synthase (GCS) (1) HCV (2) Hepcidin (1) HIV (1) HSP (1) HSV (1) IFNAR (2) Insulin Receptor (1) Integrin (2) Interleukin Related (3) Isotope-Labeled Compounds (1) JAK (1) JNK (1) Liposome (1) LPL Receptor (1) MAPKAPK2 (MK2) (1) MDM-2/p53 (1) MHC (1) Microtubule/Tubulin (1) MMP (1) MOFs (1) mTOR (1) Mucin (2) nAChR (1) Neurokinin Receptor (1) NO Synthase (3) NOD-like Receptor (NLR) (1) p38 MAPK (3) PAI-1 (1) Parasite (1) PARP (2) PD-1/PD-L1 (3) PDGFR (2) PDHK (1) PERK (1) Phosphodiesterase (PDE) (1) PI3K (5) Prostaglandin Receptor (2) Reactive Oxygen Species (ROS) (3) Reference Standards (1) ROCK (1) Sialyltransferase (1) Syk (1) TGF-β Receptor (1) TNF Receptor (3) Toll-like Receptor (TLR) (2) Topoisomerase (2) Transmembrane Glycoprotein (3) VD/VDR (1) VEGFR (5) Wnt (1) β-catenin (1)
By Research Areas:	Cancer (62) Cardiovascular Disease (14) Endocrinology (1) Infection (8) Inflammation/Immunology (34) Metabolic Disease (8) Neurological Disease (4)
Oligonucleotides:	Pegylated Lipids (1) Aptamers (2) CpG ODNs (2)

106

Inhibitors & Agonists

Screening Libraries

Fluorescent Dye

Biochemical Assay Reagents

Peptides

Inhibitory Antibodies

Natural
Products

Isotope-Labeled Compounds

Oligonucleotides

Cat. No.	Product Name	Target	Research Areas	Chemical Structure

HY-146245

ODN 1826 5+ Cited Publications CpG 1826	Toll-like Receptor (TLR) Apoptosis NO Synthase	Cardiovascular Disease Inflammation/Immunology Cancer
ODN 1826 is a class B CpG ODN (oligodeoxynucleotide) and TLR9 agonist. ODN 1826 induces NO and iNOS production and enhances Apoptosis. ODN 1826 enhances immune surveillance. ODN 1826 increases aortic atherosclerotic plaque size. ODN 1826 has antitumor activity against lung cancer, glioma and melanoma .

HY-110288

3FAx-Neu5Ac 3 Publications Verification	Sialyltransferase	Metabolic Disease
3FAx-Neu5Ac (Compound 8), a Sialic acid peracetylated analog, is a sialyltransferase inhibitor. 3FAx-Neu5Ac substantially reduces expression of the sialylated ligand sialyl Lewis X .

HY-W250111

Carboxymethyl chitosan	Biochemical Assay Reagents Apoptosis Reactive Oxygen Species (ROS) Bcl-2 Family Caspase	Cancer
Carboxymethyl chitosan is a derivative of chitosan. Carboxymethyl chitosan inhibits Apoptosis and ROS. Carboxymethyl chitosan increases the expression of Bcl-2 and reduces the expression of Bax, cytochrome c and caspase-3. Carboxymethyl chitosan inhibits the migration of various cells. Carboxymethyl chitosan exerts antitumor effects on Lewis tumors and hepatocarcinoma .

HY-146245C

ODN 1826 sodium 5+ Cited Publications CpG 1826 sodium	Toll-like Receptor (TLR) Apoptosis NO Synthase	Cardiovascular Disease Inflammation/Immunology Cancer
ODN 1826 sodium is a class B CpG ODN (oligodeoxynucleotide) and TLR9 agonist. ODN 1826 sodium induces NO and iNOS production and enhances Apoptosis. ODN 1826 sodium enhances immune surveillance. ODN 1826 sodium increases aortic atherosclerotic plaque size. ODN 1826 sodium has antitumor activity against lung cancer, glioma and melanoma .

HY-126854

N-Acetyllactosamine N-Acetyl-D-lactosamine	Endogenous Metabolite Galectin	Cardiovascular Disease
N-Acetyllactosamine (N-Acetyl-D-lactosamine), a nitrogen-containing disaccharide, is a galectin-3 inhibitor, which is an important component of various oligosaccharides such as glycoproteins and sialyl Lewis X. N-Acetyllactosamine can be used as the starting material for the synthesis of various oligosaccharides. N-Acetyllactosamine has prebiotic effects .

HY-P3479

Insulin (swine)	Insulin Receptor	Metabolic Disease
Insulin (swine) is an orally active insulin derived from pigs. Insulin (swine) when administered orally acts as an antigen to reduce the severity of pancreatic lymphocyte infiltration, but has no metabolic effect on blood glucose levels. Insulin (swine) increases glucose oxidation, stimulates lipogenesis, and lowers blood glucose levels. Insulin (swine) can be used in diabetes research .

HY-129630

Tetrahydrocortisol	Microtubule/Tubulin	Neurological Disease Cancer
Tetrahydrocortisol is a cortisol metabolite that inhibits dexamethasone-induced formation of cross-linked actin networks. Tetrahydrocortisol can be used in the research of primary open-angle glaucoma, glucocorticoid-induced ocular hypertension, Lewis lung carcinoma, and EMT-6 mouse breast cancer .

HY-167036

DMG-PEG2000-Mal	Biochemical Assay Reagents	Others
DMG-PEG2000-Mal is a pegylated lipid with a molecular weight of 2000. DMG-PEG-Mal serves as a component of lipid nanoparticles for mRNA delivery .

HY-113462

α-Carotene	Others	Cancer
α-Carotene, a precursor of vitamin A, is used as an anti-metastatic agent or as an adjuvant for anti-cancer agents. α-Carotene is isolated from yellow-orange and dark-green vegetables .

HY-B1214

Prednisolone acetate Prednisolone 21-acetate	Glucocorticoid Receptor	Inflammation/Immunology Cancer
Prednisolone acetate (Prednisolone 21-acetate) is an adrenocortical hormone active molecule with various pharmacological effects such as anti-inflammatory, anti-allergic, and immune suppression.

HY-W020014

Pyruvic aldehyde (40%w/w in water) 1 Publications Verification	Biochemical Assay Reagents Drug Intermediate	Cardiovascular Disease
Pyruvic aldehyde (40%w/w in water) is a cell stabilizer. Pyruvic aldehyde (40%w/w in water) can be used for stabilization of cells, such as erythrocytes. Pyruvic aldehyde (40%w/w in water) can be efficiently catalyzed to Lactic acid (HY-B2227) by a Lewis acid catalyst .

HY-W020790

*Sialyl-Lewis* X** 1 Publications Verification sLeX	Endogenous Metabolite	Inflammation/Immunology
Sialyl-Lewis X (sLeX) is a sialylated fucosylated tetrasaccharide, an endogenous antigen. Sialyl-Lewis X is a high-affinity ligand for selectins (E-, P-, and L-selectin) . Sialyl-Lewis X binds to ELAM-1 and CD62 and has the ability?to inhibits CD62-mediated neutrophil recruitment to sites of inflammation .

HY-B0328

Triamcinolone 2 Publications Verification	Glucocorticoid Receptor Interleukin Related	Cardiovascular Disease Inflammation/Immunology Endocrinology Cancer
Triamcinolone is a long-acting corticosteroid with anti-inflammatory, anti-oedematous, anti-proliferative, anti-angiogenetic, immunomodulatory and neuroprotective effects through binding to glucocorticoid receptors. Triamcinolone can relieve several dermatitis, immune diseases and ocular diseases .

HY-N10535

Lewis y tetrasaccharide Lewis y	FAK	Cancer
Lewis Y tetrasaccharide (Lewis Y, Le ^Y) is a tetrasaccharide derivative form of Lewis X trisaccharide (HY-N10534). Lewis Y tetrasaccharide is an antigen associated with malignant ovarian carcinomas metastasis and poor prognosis .

HY-P1408

Obtustatin 4 Publications Verification	Integrin VEGFR	Cancer
Obtustatin is a non-RGD disintegrin consisting of 41 residues. Obtustatin inhibits the adhesion of α1β1 integrin to type IV Collagen (HY-NP003), blocks α1β1 integrin signaling in endothelial cells, and suppresses FGF2-induced angiogenesis. Obtustatin inhibits tumor progression in mouse models and upregulates VEGF expression in sarcoma-bearing mice. Obtustatin can be used in research related to Lewis lung carcinoma and S-180 sarcoma .

HY-N7575

Lacto-N-fucopentaose II LNFP II	Endogenous Metabolite	Metabolic Disease Cancer
Lacto-N-fucopentaose II (LNFP II) is a sialyl-Lewis, hapten of human Lewis bloodgroup determinant. Lacto-N-fucopentaose II monosialo-ganglioside/glycolipid and sialyl derivative, CA 19-9, is a molecular tumour markers (TM) for biliopancreatic malignancy .

HY-N0120

(E/Z)-Polydatin (E/Z)-Piceid	Drug Isomer	Cardiovascular Disease Metabolic Disease Inflammation/Immunology Cancer
(E/Z)-Polydatin ((E/Z)-Piceid) is a mixture of the E/Z configurations of Polydatin (HY-N0120A). Polydatin can be isolated from Polygonum cuspidatum, grapes, peanuts, red wine, hop pellets, cocoa-containing products and chocolate products. Polydatin exhibits multiple biological properties, such as anti-platelet aggregation, anti-low-density lipoprotein oxidation, cardioprotective activity, anti-inflammatory and immunomodulatory functions. Polydatin shows favorable cytotoxic effects against various tumor cell lines, including cervical cancer cells, liver cancer cells, and nasopharyngeal carcinoma cells .

HY-13718

Oglufanide H-Glu-Trp-OH; L-Glutamyl-L-tryptophan	VEGFR HCV Endogenous Metabolite	Infection Cardiovascular Disease Inflammation/Immunology Cancer
Oglufanide (H-Glu-Trp-OH) is a dipeptide immunomodulator isolated from calf thymus. Oglufanide inhibits vascular endothelial growth factor (VEGF). Oglufanide can stimulate the immune response to hepatitic C virus (HCV) and intracellular bacterial infections. Oglufanide shows antitumor and anti-angiogenesis activities .

HY-160109

Ac5GalNTGc 1 Publications Verification	Mucin	Inflammation/Immunology Cancer
Ac5GalNTGc is a potent, peracetylated C-2 thioglycolyl-substituted GalNAc analog that efficiently inhibits mucin-type O-glycan biosynthesis. Ac5GalNTGc reduces leukocyte sialyl-Lewis-X expression and inhibits L-/P-selectin mediated rolling under flow, as well as P-selectin dependent leukocyte-platelet adhesion. Ac5GalNTGc exhibits anti-inflammatory activity in a thioglycollate-induced acute peritonitis model. Ac5GalNTGc can be used for studies of O-glycan/mucin biology, inflammation, and related translational research .

HY-W008525

Tris(perfluorophenyl)borane	Biochemical Assay Reagents	Others
Tris (perfluorophenyl) borane is a biochemical reagent that can be used as a biomaterial or organic compound for life science-related research .

HY-P11328

GFOGER peptide	Integrin	Others
GFOGER peptide is an artificially synthesized collagen-mimetic sequence. GFOGER peptide acts as a ligand for α2β1, α11β1 and α1β1 integrins, thereby supporting integrin-mediated cell adhesion to collagen. GFOGER peptide triggers signaling pathways mediated by the α2β1 integrin receptor and upregulates osteoblast differentiation. GFOGER peptide accelerates and enhances bone formation at sites of refractory femoral defects. GFOGER peptide can be passively adsorbed onto polymer scaffolds for cell-free/growth factor-free bone formation. GFOGER peptide is used in biomaterials such as hydrogels and 3D bioinks for tissue engineering research including bone formation .

HY-21179

Trimethylsilyl trifluoromethylsulfonate	Biochemical Assay Reagents	Others
Trimethylsilyl trifluoromethylsulfonate is a metal-free catalyst. Trimethylsilyl trifluoromethylsulfonate can be used for the synthesis of biologically active fluorinated heterocyclic compounds .

HY-107194

NSC12	FGFR c-Myc DNA/RNA Synthesis Caspase Reactive Oxygen Species (ROS)	Cancer
NSC12 is an orally active pan-FGF trap. NSC12 inhibits the interaction between FGF2/FGFR. NSC12 suppresses the phosphorylation of FGFR3. NSC12 reduces c-Myc levels, induces DNA damage, triggers the cleavage of Caspase 3, and promotes ROS production. NSC12 exhibits anticancer activity against lung cancer and multiple myeloma .

HY-N10534

Lewis X trisaccharide Lewis X	Parasite	Infection Inflammation/Immunology Cancer
Lewis X trisaccharide (Lewis X, Le ^x) is a potent T_H2 regulator, antagonizes LPS-induced IL-12 immune expression. Lewis X trisaccharide is a human histo-blood group antigen, plays an key role in cell-cell adhesion, and servers as a tumor marker. Lewis X trisaccharide is highly expressed in the outer membrane of the parasite, can be used for the immunology research of schistosomiasis .

HY-P3023

Mutanolysin	Bacterial TNF Receptor	Infection Metabolic Disease Inflammation/Immunology
Mutanolysin is a bacteriolytic agent. Mutanolysin is a muralytic enzyme that can prevent hepatic injury. Mutanolysin can digest the cell wall of S. mutans BHT and shows antibacterial activity. Mutanolysin reduces TNF-α production in isolated Kupffer cells stimulated with peptidoglycan-polysaccharide (PG-APS). Mutanolysin can be used for the researches of infection, inflammation and hepatic injury .

HY-P4191A

Met-RANTES (human) acetate	CCR	Inflammation/Immunology
Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC₅₀ of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .

HY-149814

PDK-IN-1	PDHK HSP	Cancer
PDK-IN-1 (compound 7o) is a pyruvate dehydrogenase kinase (PDK) inhibitor. PDK-IN-1 shows IC₅₀ values of 0.03 and 0.1 μM for PDK1 and HSP90, respectively. PDK-IN-1 targets PDH/PDK axis thus reducing efficiently the tumor mass .

HY-136198

SRX3207	Syk PI3K	Cancer
SRX3207 is an orally active and first-in-class dual Syk/PI3K inhibitor, with IC₅₀ values of 10.7 nM and 861 nM for Syk and PI3Kα, respectively. SRX3207 relieves tumor immunosuppression .

HY-15266

24R-Calcipotriol PRI 2202; Impurity D of Calcipotriol	Drug Derivative VD/VDR	Cancer
24R-Calcipotriol (PRI 2202; Impurity D of Calcipotriol), an isomer of Calcipotriol (HY-10001), is a synthetic vitamin D analog. 24R-Calcipotriol exhibits synergistic antiproliferative effects with low-dose cytostatics in in vitro. 24R-Calcipotriol produces tumor growth inhibition when combined with Cyclophosphamide (HY-17420) and Cisplatin (HY-17394) in mice models. 24R-Calcipotriol can increase serum calcium levels and reduce blood leukocyte counts . 24R-Calcipotriol can be used for the research of mammary cancer and Lewis lung cancer .

HY-N10531

Lewis a trisaccharide Lewis a	Others	Others
Lewis a trisaccharide (Lewis a) is a trisaccharide that has been found to be present in the glycan structures of spermatozoa. Lewis a trisaccharide also is a major component of the glycan structures on the surface of HL-60 cells .

HY-W033277

Tetrakis(acetonitrile)palladium(II) tetrafluoroborate NSC 307191; Palladium(II) tetrafluoroborate tetraacetonitrile complex	Drug Intermediate Endogenous Metabolite	Others
Tetrakis(acetonitrile)palladium(II) tetrafluoroborate (NSC 307191) acts as a potent Lewis acid and facilitates the formation of the 2:1 complex [Pd(1,2-bis(2′-pyridylethynyl)benzene)2](BF4)2 through the Sonogashira cross-coupling reaction.

HY-E70284

Keratanase II,bacillus circulans,expressed in E.coli	Biochemical Assay Reagents	Others
Keratanase II,bacillus circulans,expressed in E.coli has transglycosylation activity. Keratanase II,bacillus circulans,expressed in E.coli efficiently catalyzes the transglycosylation of α(2→3)-sialylated 6,6′-di-sulfo-LacNAc with two kinds of glycosyl acceptors, 6-sulfo-Lewis X and 6,6'-di-sulfo-LacNAc derivatives, providing Sialyl sulfo-hexasaccharide and Sialyl sulfo-pentasaccharide .

HY-W854445

Lewis-b tetrasaccharide 1 Publications Verification	Biochemical Assay Reagents	Others
Lewis-b tetrasaccharide is a class of biochemical reagents used in glycobiology research. Glycobiology studies the structure, synthesis, biology, and evolution of sugars. It involves carbohydrate chemistry, enzymology of glycan formation and degradation, protein-glycan recognition, and the role of glycans in biological systems. This field is closely related to basic research, biomedicine, and biotechnology .

HY-E70059

alpha-1,2-Fucosyltransferase (α1,2FucT)	Glucosylceramide Synthase (GCS)	Cancer
alpha-1,2-Fucosyltransferase (α1,2FucT), i.e., alpha 1, 2-fucosyltransferase, is often used in biochemical studies. alpha-1,2-Fucosyltransferase is a rate-limiting enzyme, can catalyze the synthesis of Lewis y (a cell membrane-associated carbohydrate antigen) .

HY-129630S

Tetrahydrocortisol-d5	Isotope-Labeled Compounds Endogenous Metabolite	Metabolic Disease
Tetrahydrocortisol-d₅ is the deuterium labeled Tetrahydrocortisol. Tetrahydrocortisol is a cortisol metabolite that inhibits dexamethasone-induced formation of cross-linked actin networks. Tetrahydrocortisol can be used in the research of primary open-angle glaucoma, glucocorticoid-induced ocular hypertension, Lewis lung carcinoma, and EMT-6 mouse breast cancer .

HY-132202

PD-1/PD-L1-IN-10	PD-1/PD-L1 Apoptosis	Cancer
PD-1/PD-L1-IN-10 (compound B2) is an orally active PD-1/PD-L1 inhibitor (IC₅₀ of 2.7 nM) with potent anticancer efficacy .

HY-160047

AX102 sodium	PDGFR	Cancer
AX102 sodium is a 34 bp length nucleotide aptamer modified at the 5' end with a 40 kDa polyethylene glycol moiety. AX102 selectively binds platelet-derived growth factor B (PDGF-B) and causes tumor vessel regression .

HY-W854385A

*Sialyl Lewis* A sodium** 1 Publications Verification SLeA sodium	Biochemical Assay Reagents	Cancer
Sialyl Lewis A sodium (SLeA sodium) is a carbohydrate-type antigen that can serve as a tumor marker, with upregulation observed in various tumor cells such as cervical cancer, human pancreatic cancer, and colon cancer cells. Sialyl Lewis A sodium is involved in the migration and adhesion of tumor cells. Additionally, elevated expression of Sialyl Lewis A sodium may also lead to pregnancy abnormalities .

HY-W854385

*Sialyl Lewis* A** SLeA	Biochemical Assay Reagents	Cancer
Sialyl Lewis A (SLeA) is a carbohydrate-type antigen that can serve as a tumor marker, with upregulation observed in various tumor cells such as cervical cancer, human pancreatic cancer, and colon cancer cells. Sialyl Lewis A is involved in the migration and adhesion of tumor cells. Additionally, elevated expression of Sialyl Lewis A may also lead to pregnancy abnormalities .

HY-12835

S1P1 agonist III	LPL Receptor	Inflammation/Immunology
S1P1 agonist III is an orally active hS1P1 agonist with an EC₅₀ value of 18 nM. S1P1 agonist III shows limited activity against hS1P3. S1P1 agonist III can be used in the research of multiple sclerosis .

HY-W145535

*Sialyl lewis* x-lactose**	Biochemical Assay Reagents Endogenous Metabolite	Others
Sialyl Lewis X-Lactose is a biochemical reagent that can be used as a biological material or organic compound for life science related research.

HY-19015

Probimane AT-2153	Calmodulin	Cancer
Probimane (AT-2153) is a potent anticancer agent. Probimane is effective against mouse tumors S37, S180, Lewis lung carcinoma, L1210 and human pulmonary adenocarcinoma heterotransplanted into nude mice .

HY-162863

ERK-MYD88 interaction inhibitor 1	Apoptosis	Cancer
ERK-MYD88 interaction inhibitor 1 is an ERK-MYD88 interaction inhibitor. ERK-MYD88 interaction inhibitor 1 can induce an HRI-mediated integrated stress response (ISR), leading to cancer cell-specific immunogenic cell apoptosis (apoptosis). ERK-MYD88 interaction inhibitor 1 can induce anti-tumor T cell responses in Lewis lung cancer mice, exhibiting anti-tumor activity .

HY-E70303

Fucosyltransferase 6 FUT6	Endogenous Metabolite	Cancer
Fucosyltransferase 6 is a fucosyltransferase that mediates the expression of the tetrasaccharide Sialyl-Lewis x (sLex, CD15s) on the surface of leukocytes. sLex participates in E-selectin-mediated leukocyte rolling and is related to the migration of leukocytes out of blood vessels .

HY-125443

Lucialdehyde A	Others	Cancer
Lucialdehydes A is a lanostante-type triterpene aldehydes, isolated from the fruiting bodies of Ganoderma lucidum. Lucialdehydes A shows cytotoxic effects on tumor cells, including Lewis lung carcinoma (LLC), T-47D, Sarcoma 180, and Meth-A tumor cell lines .

HY-108164

Aspidin BB	Apoptosis Bcl-2 Family Caspase	Cancer
Aspidin BB is a phloroglucinol derivative, which can be isolated from the aerial part of Dryopteris championii. Aspidin BB has anticancer activity. Aspidin BB induces cell cycle arrest and apoptosis in human ovarian HO-8910 cells .

HY-W142631

4-(Phenylazo)diphenylamine	Fluorescent Dye	Cancer
4-(Phenylazo)diphenylamine is an excellent colorimetric indicator for the accurate determination of the concentration for a variety of strong bases, Lewis acids, and hydride reducing agents .

HY-P2045

RA-VII	Arp2/3 Complex	Cancer
RA-VII is an antitumor agent that exhibits significant activity against L1210, B-16 melanoma, Lewis lung carcinoma, Colon 38 and Ehrlich carcinoma .

HY-E70156

Fucosyltransferase 7 EC:2.4.1.-; FUT7	Biochemical Assay Reagents	Others
Fucosyltransferase 7 (FUT7) is a golgi stack membrane protein. Fucosyltransferase 7catalyzes the final fucosylation step in the synthesis of Lewis antigens and generates a unique glycosylated product sialyl Lewis X (sLeX). Fucosyltransferase 7 catalyzes alpha-1,3 glycosidic linkages involved in the expression of sialyl Lewis X antigens .

HY-175369

PI3Kδ-IN-25	PI3K Akt PD-1/PD-L1 Interleukin Related CD3	Inflammation/Immunology Cancer
PI3Kδ-IN-25 is an orally active selective PI3Kδ inhibitor (IC₅₀ = 2.1 nM). PI3Kδ-IN-25 has IC₅₀s of 272, 285, and 1171 nM for PI3Kα, PI3Kγ, and PI3Kβ, respectively. PI3Kδ-IN-25 inhibits AKT Ser473 phosphorylation, suppresses Treg cell proliferation, and downregulates PD-L1 expression in B16F10 cells. PI3Kδ-IN-25 exhibits anticancer effects in B16F10 melanoma and Lewis lung cancer mouse models by reducing tumor-infiltrating Treg cells and enhancing immune responses. PI3Kδ-IN-25 is potentially useful in the study of melanoma, lung cancer, and other cancers .

Cat. No.	Product Name

HY-L924

Boronic acid/boronic ester fragment library

1,488 compounds

Boronic acid and boronic ester represent a relatively novel and promising chemical structure in drug design. Boronic acid exists in an sp²-hybridized state, possessing an empty p-orbital that can act as a Lewis acid to accept lone pairs from heteroatoms (O, N, or S). This Lewis acidity enables it to form reversible covalent bonds with amino acid residues such as lysine, serine, threonine, and histidine. Currently, five FDA-approved drugs containing boronic acid or boronic ester predominantly involve such covalent binding mechanisms in their interactions with target proteins. Furthermore, boronic acid can serve as a bioisostere for carboxylic acids, phosphates, and phenolic groups, utilized to improve pharmacokinetic properties and enhance drug efficacy.

To date, five boron-containing drugs have been approved by the FDA. The unique properties of boronic acids and boronic esters confer significant potential in drug design, with applications spanning cancer therapy (e.g., multiple myeloma), anti-infectives (e.g., fungal infections, tuberculosis), anti-inflammatory treatments (e.g., atopic dermatitis), antibacterial agents (e.g., carbapenem-resistant bacterial infections), and Reactive Oxygen Species (ROS)-responsive prodrugs, among others. The MCE Boronic Acid/Boronic Ester Fragment Library, which contains 1,488 compounds, serves as a valuable tool for the development of boron-containing drugs.

Cat. No.	Product Name	Type

HY-W142631

4-(Phenylazo)diphenylamine	Fluorescent Dye
4-(Phenylazo)diphenylamine is an excellent colorimetric indicator for the accurate determination of the concentration for a variety of strong bases, Lewis acids, and hydride reducing agents .

HY-DY1092

Chlorin e6 (solution)

Ce6 (solution)

Fluorescent Dye

Chlorin e6 (solution) (Ce6 (solution)) is a photosensitizer and has strong absorption peaks at wavelength of 402 and 662 nm, as well as exhibiting intense fluorescence at 668 nm. Chlorin e6 has antimicrobial efficacy and anticancer activity. Chlorin e6 induces cell apoptosis via caspase-3 activation and can be used for the research of cancer .
Solvent and concentration: DMSO: 10 mM
The 1 mL volume is defined as the base specification. All larger sizes correspond to incremental volumes of this base.

Cat. No.	Product Name	Type

HY-W250111

Carboxymethyl chitosan	Biochemical Assay Reagents
Carboxymethyl chitosan is a derivative of chitosan. Carboxymethyl chitosan inhibits Apoptosis and ROS. Carboxymethyl chitosan increases the expression of Bcl-2 and reduces the expression of Bax, cytochrome c and caspase-3. Carboxymethyl chitosan inhibits the migration of various cells. Carboxymethyl chitosan exerts antitumor effects on Lewis tumors and hepatocarcinoma .

HY-167036

DMG-PEG2000-Mal	Biochemical Assay Reagents
DMG-PEG2000-Mal is a pegylated lipid with a molecular weight of 2000. DMG-PEG-Mal serves as a component of lipid nanoparticles for mRNA delivery .

HY-W008525

Tris(perfluorophenyl)borane	Biochemical Assay Reagents
Tris (perfluorophenyl) borane is a biochemical reagent that can be used as a biomaterial or organic compound for life science-related research .

HY-W854445

Lewis-b tetrasaccharide

1 Publications Verification

Biochemical Assay Reagents

Lewis-b tetrasaccharide is a class of biochemical reagents used in glycobiology research. Glycobiology studies the structure, synthesis, biology, and evolution of sugars. It involves carbohydrate chemistry, enzymology of glycan formation and degradation, protein-glycan recognition, and the role of glycans in biological systems. This field is closely related to basic research, biomedicine, and biotechnology .

HY-W145535

*Sialyl lewis* x-lactose**	Biochemical Assay Reagents
Sialyl Lewis X-Lactose is a biochemical reagent that can be used as a biological material or organic compound for life science related research.

HY-E70156

Fucosyltransferase 7 EC:2.4.1.-; FUT7	Biochemical Assay Reagents
Fucosyltransferase 7 (FUT7) is a golgi stack membrane protein. Fucosyltransferase 7catalyzes the final fucosylation step in the synthesis of Lewis antigens and generates a unique glycosylated product sialyl Lewis X (sLeX). Fucosyltransferase 7 catalyzes alpha-1,3 glycosidic linkages involved in the expression of sialyl Lewis X antigens .

HY-158459

A2G2F2 glycan A2G2F2(a1-3) glycan	Biochemical Assay Reagents
A2G2F2 glycan (A2G2F2(a1-3) glycan) is a Lewis X polysaccharide containing two Lewis X epitopes and is a symmetric N-glycan. SLeX is a ligand for the cell adhesion molecule E-selectin, which is specifically expressed at sites of inflammatory lesions. Designing SLeX-polysaccharide conjugates to deliver drugs to inflammatory lesions .

HY-W698344

Lewis X Trisaccharide,Methyl Glycoside

Biochemical Assay Reagents

Lewis X Trisaccharide,Methyl Glycoside is a class of biochemical reagents used in glycobiology research. Glycobiology studies the structure, synthesis, biology, and evolution of sugars. It involves carbohydrate chemistry, enzymology of glycan formation and degradation, protein-glycan recognition, and the role of glycans in biological systems. This field is closely related to basic research, biomedicine, and biotechnology .

HY-E70158

Fucosyltransferase 9 EC:2.4.1.152; FUT9	Biochemical Assay Reagents
Fucosyltransferase 9 (EC:2.4.1.152, FUT9) catalyzes the last step in the biosynthesis of Lewis antigen, the addition of a fucose to precursor polysaccharides. Fucosyltransferase 9 synthesizes the LeX oligosaccharide (CD15) .

HY-158458

A2[3]G1F1(α-1-3) glycan A2[3]G1F1(a1-3) glycan	Biochemical Assay Reagents
A2[3]G1F1(α-1-3) glycan (A2[3]G1F1(a1-3) glycan) is an asymmetric Lewis X polysaccharide and N-glycan. SLeX is a ligand for the cell adhesion molecule E-selectin, which is specifically expressed at sites of inflammatory lesions. Designing SLeX-polysaccharide conjugates to deliver drugs to inflammatory lesions .

HY-158457

A2[3]G1 N-glycan N/A	Biochemical Assay Reagents
A2[3]G1 N-glycan (N/A) is a Lewis sugar. SLeX is a ligand for the cell adhesion molecule E-selectin, which is specifically expressed at sites of inflammatory lesions. Designing SLeX-polysaccharide conjugates to deliver drugs to inflammatory lesions .

HY-158522

A2[3]G1 & A2[6]G1 glycan (G1), 2-AB labelled A2[3]G1 & A2[6]G1 N-linked oligosaccharide, 2-AB labelled	Biochemical Assay Reagents
A2[3]G1 & A2[6]G1 glycan (G1), 2-AB labeled Lewis sugar. SLeX is a ligand for the cell adhesion molecule E-selectin (E-selectin), which is specifically expressed at sites of inflammatory lesions. Designing SLeX-polysaccharide conjugates to deliver drugs to inflammatory lesions .

HY-158495

A2 glycan (G0), 2-AA labelled A2 N-linked oligosaccharide, 2-AA labelled	Biochemical Assay Reagents
A2[3]G1 & A2[6]G1 glycan (G1), 2-AB labeled Lewis sugar. SLeX is a ligand for the cell adhesion molecule E-selectin (E-selectin), which is specifically expressed at sites of inflammatory lesions. Designing SLeX-polysaccharide conjugates to deliver drugs to inflammatory lesions .

Cat. No.	Product Name	Target	Research Area

HY-P3479

Insulin (swine)	Insulin Receptor	Metabolic Disease
Insulin (swine) is an orally active insulin derived from pigs. Insulin (swine) when administered orally acts as an antigen to reduce the severity of pancreatic lymphocyte infiltration, but has no metabolic effect on blood glucose levels. Insulin (swine) increases glucose oxidation, stimulates lipogenesis, and lowers blood glucose levels. Insulin (swine) can be used in diabetes research .

HY-P5766

AChRα(97-116)	nAChR
AChRα(97-116) is a synthetic peptide corresponding to the 97-116 region of the rat acetylcholine receptor α-subunit, and also an inducer of autoimmune diseases. AChRα(97-116) can be used in studies related to experimental autoimmune myasthenia gravis .

HY-P1408

Obtustatin 4 Publications Verification	Integrin VEGFR	Cancer
Obtustatin is a non-RGD disintegrin consisting of 41 residues. Obtustatin inhibits the adhesion of α1β1 integrin to type IV Collagen (HY-NP003), blocks α1β1 integrin signaling in endothelial cells, and suppresses FGF2-induced angiogenesis. Obtustatin inhibits tumor progression in mouse models and upregulates VEGF expression in sarcoma-bearing mice. Obtustatin can be used in research related to Lewis lung carcinoma and S-180 sarcoma .

HY-P0131A

Laminin peptide CDPGYIGSR TFA Laminin (925-933) TFA	Peptides	Cancer
Laminin peptide CDPGYIGSR (Laminin (925-933)) TFA is a 67 kDa laminin receptor ligand and selective cell adhesion inducer. Laminin peptide CDPGYIGSR TFA not only promotes cell adhesion and mediates directed neurite outgrowth via matrix coating or covalent immobilization, but also inhibits neural crest cell migration under specific conditions. Laminin peptide CDPGYIGSR TFA inhibits lung colonization of melanoma cells, and suppresses the growth of Sarcoma 180 solid tumors and Lewis lung carcinoma (3LL) in mice. Laminin peptide CDPGYIGSR TFA also exerts significant anti-angiogenic effects by inhibiting embryonic angiogenesis in the chick chorioallantoic membrane and vascular endothelial cell migration induced by tumor-conditioned medium. Laminin peptide CDPGYIGSR TFA can be widely used in studies related to melanoma, Sarcoma 180, Lewis lung carcinoma (3LL), and other relevant areas .

HY-13718

Oglufanide H-Glu-Trp-OH; L-Glutamyl-L-tryptophan	VEGFR HCV Endogenous Metabolite	Infection Cardiovascular Disease Inflammation/Immunology Cancer
Oglufanide (H-Glu-Trp-OH) is a dipeptide immunomodulator isolated from calf thymus. Oglufanide inhibits vascular endothelial growth factor (VEGF). Oglufanide can stimulate the immune response to hepatitic C virus (HCV) and intracellular bacterial infections. Oglufanide shows antitumor and anti-angiogenesis activities .

HY-P11328

GFOGER peptide	Integrin	Others
GFOGER peptide is an artificially synthesized collagen-mimetic sequence. GFOGER peptide acts as a ligand for α2β1, α11β1 and α1β1 integrins, thereby supporting integrin-mediated cell adhesion to collagen. GFOGER peptide triggers signaling pathways mediated by the α2β1 integrin receptor and upregulates osteoblast differentiation. GFOGER peptide accelerates and enhances bone formation at sites of refractory femoral defects. GFOGER peptide can be passively adsorbed onto polymer scaffolds for cell-free/growth factor-free bone formation. GFOGER peptide is used in biomaterials such as hydrogels and 3D bioinks for tissue engineering research including bone formation .

HY-P4191A

Met-RANTES (human) acetate	CCR	Inflammation/Immunology
Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC₅₀ of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .

HY-12523

Peptide M	Peptides	Others
Peptide M is a synthetic amino acid (18 amino acids in length which correspond to the amino acid positions 303-322 of bovine S-antigen: DTNLASSTIIKEGIDKTV), is capable of inducing experimental autoimmune uveitis in monkeys and Hartley guinea pigs as well as Lewis rats .

HY-P2479

Peripheral Myelin Protein P2 (53-78), bovine	Peptides	Inflammation/Immunology
Peripheral Myelin Protein P2 (53-78), bovine is derived from bovine peripheral myelin P2 protein amino acid residues 53-78. Peripheral Myelin Protein P2 (53-78), bovine is a T cell epitope for the induction of experimental autoimmune neuritis (EAN) in Lewis rats .

HY-P10503

S2-16	Peptides	Cardiovascular Disease Others Inflammation/Immunology
S2-16 is a synthetic peptide from the S2 region of cardiac myosin. S2-16 is a cryptic epitope that induces myocarditis in Lewis rats. A cryptic epitope is an epitope that is not recognized by antibodies or T cells after the animal is immunized with the intact antigen. S2-16 can be used to study the mechanism of autoimmune myocarditis .

HY-P2045

RA-VII	Arp2/3 Complex	Cancer
RA-VII is an antitumor agent that exhibits significant activity against L1210, B-16 melanoma, Lewis lung carcinoma, Colon 38 and Ehrlich carcinoma .

HY-P4191

Met-RANTES (human) MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN	CCR	Inflammation/Immunology
Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC₅₀ of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .

HY-P4676A

Lys-(Des-Arg9,Leu8)-Bradykinin TFA	Bradykinin Receptor	Inflammation/Immunology
Lys-(Des-Arg9,Leu8)-Bradykinin TFA is a selective bradykinin B1 receptor (BDKRB1) antagonist. Lys-(Des-Arg9,Leu8)-Bradykinin TFA inhibits local inflammatory edema. Lys-(Des-Arg9,Leu8)-Bradykinin TFA induces the production of systemic acute-phase proteins. Lys-(Des-Arg9,Leu8)-Bradykinin TFA is applicable to research related to peptidoglycan-polysaccharide-induced acute arthritis .

Cat. No.	Product Name	Target	Research Area	Image

HY-P990632

MVT-5873 HuMab-5B1	Inhibitory Antibodies	Inflammation/Immunology
MVT-5873 is a humanized antibody expressed in CHO cells, targeting *Sialyl-Lewis* A**. MVT-5873 has a huIgG1 heavy chain and a huλ light chain, with a predicted molecular weight (MW) of 145.66 kDa. The isotype control for MVT-5873 can refer to Human IgG1 kappa, Isotype Control (HY-P99001).

HY-P990622

MB-311	Transmembrane Glycoprotein	Inflammation/Immunology
MB-311 is a humanized antibody expressed in CHO cells, targeting Lewis Y. MB-311 has a huIgG1 heavy chain and a huλ light chain, with a predicted molecular weight (MW) of 150 kDa. The isotype control for MB-311 can refer to Human IgG1 kappa, Isotype Control (HY-P99001).

HY-P991458

hu3S193	Transmembrane Glycoprotein	Cancer
hu3S193 is a human IgG monoclonal antibody (mAb) targeting Lewis Y. hu3S193 has excellent immune effector function (complement-dependent cytotoxicity) (IC₅₀: 1.0 μg/ml) and antibody-dependent cellular cytotoxicity (IC₅₀: 5.0 μg/ml). hu3S193 can be used in small cell lung cancer (SCLC) research. Recommended isotype control: Human IgG1 kappa, Isotype Control (HY-P99001) .

HY-P991426

MB-314	Transmembrane Glycoprotein IFNAR TNF Receptor	Cancer
MB-314 is a human IgG1 monoclonal antibody (mAb) targeting Lewis Y. MB-314 induces enhanced antibody-dependent cell-mediated cytotoxicity (ADCC) activity. MB-314 increases the release of IFN-γ, TNF-α, MCP-1, and IL-6. MB-314 can be used in cancer research .

HY-P992201

Anti-CD160 Antibody (MAT 302) CL1-R2	MHC Apoptosis IFNAR TNF Receptor Interleukin Related Akt mTOR	Cardiovascular Disease Neurological Disease Cancer
Anti-CD160 Antibody (MAT 302) (CL1-R2) is a human monoclonal antibody targeting CD160. Anti-CD160 Antibody (MAT 302) blocks the CD160-HVEM protein interaction, inhibits FGF2-mediated renal tubular vascular growth, and induces endothelial cell apoptosis. Anti-CD160 Antibody (MAT 302) targets CD160 on neovascularization to exert anti-angiogenic and vascular normalization effects, trigger the production of IFN-γ, TNF and IL-6 by NK cells, and enhance glucose metabolism of NK cells through the AKT/mTOR/s6k signaling pathway. Anti-CD160 Antibody (MAT 302) reduces vascular density, normalizes remaining tumor blood vessels, and inhibits tumor growth in melanoma-bearing mice. Anti-CD160 Antibody (MAT 302) can be used in research related to neovascularization, proliferative diabetic retinopathy, and melanoma .

HY-P991881

KY1070	TGF-β Receptor Hepcidin Ferroportin	Cardiovascular Disease
KY1070 is a fully human anti-BMP6 antibody with a K_d of 0.00014 μM against the human BMP6. It exhibits high specificity for BMP6, showing no cross-reactivity with other members of the BMP family, and effectively inhibits BMP6-induced BMP receptor heterodimerization and hepcidin expression. KY1070 modulates Ferroportin expression on erythroid progenitor cells and accelerates erythropoiesis. In rodent anemia models, KY1070 reduces the required dose of erythropoietin (EPO) when used in combination with EPO and enhances the responsiveness of mice with chronic kidney disease (CKD)-associated anemia to EPO treatment. KY1070 is applicable for research on anemia of chronic disease ^{[1] [2]}.

Cat. No.	Product Name	Category	Target	Chemical Structure

HY-126854

N-Acetyllactosamine N-Acetyl-D-lactosamine	Natural Products Microorganisms	Endogenous Metabolite Galectin
N-Acetyllactosamine (N-Acetyl-D-lactosamine), a nitrogen-containing disaccharide, is a galectin-3 inhibitor, which is an important component of various oligosaccharides such as glycoproteins and sialyl Lewis X. N-Acetyllactosamine can be used as the starting material for the synthesis of various oligosaccharides. N-Acetyllactosamine has prebiotic effects .

HY-129630

Tetrahydrocortisol	Structural Classification Classification of Application Fields Metabolic Disease Endogenous metabolite Disease Research Fields Steroids Source Classification	Microtubule/Tubulin
Tetrahydrocortisol is a cortisol metabolite that inhibits dexamethasone-induced formation of cross-linked actin networks. Tetrahydrocortisol can be used in the research of primary open-angle glaucoma, glucocorticoid-induced ocular hypertension, Lewis lung carcinoma, and EMT-6 mouse breast cancer .

HY-113462

α-Carotene	Other Terpenoids Classification of Application Fields Terpenoids Pigments Decachaeta ovatifolia (DC.) R.M.King & H.Rob. Umbelliferae Plants Disease Research Fields Source Classification Cancer Food Research	Others
α-Carotene, a precursor of vitamin A, is used as an anti-metastatic agent or as an adjuvant for anti-cancer agents. α-Carotene is isolated from yellow-orange and dark-green vegetables .

HY-W020014

Pyruvic aldehyde (40%w/w in water) 1 Publications Verification	Structural Classification Immune System Disorder Classification of Application Fields Ketones, Aldehydes, Acids Disease markers Other Diseases Endocrine diseases Endogenous metabolite Disease Research Fields Source Classification	Biochemical Assay Reagents Drug Intermediate
Pyruvic aldehyde (40%w/w in water) is a cell stabilizer. Pyruvic aldehyde (40%w/w in water) can be used for stabilization of cells, such as erythrocytes. Pyruvic aldehyde (40%w/w in water) can be efficiently catalyzed to Lactic acid (HY-B2227) by a Lewis acid catalyst .

HY-W020790

*Sialyl-Lewis* X** 1 Publications Verification sLeX	Polysaccharides Classification of Application Fields Endogenous metabolite Inflammation/Immunology Disease Research Fields Saccharides Source Classification	Endogenous Metabolite
Sialyl-Lewis X (sLeX) is a sialylated fucosylated tetrasaccharide, an endogenous antigen. Sialyl-Lewis X is a high-affinity ligand for selectins (E-, P-, and L-selectin) . Sialyl-Lewis X binds to ELAM-1 and CD62 and has the ability?to inhibits CD62-mediated neutrophil recruitment to sites of inflammation .

HY-B0328

Triamcinolone 2 Publications Verification	Classification of Application Fields Solanum lyratum Thunberg Solanaceae Plants Inflammation/Immunology Disease Research Fields Steroids Source Classification Cancer	Glucocorticoid Receptor Interleukin Related
Triamcinolone is a long-acting corticosteroid with anti-inflammatory, anti-oedematous, anti-proliferative, anti-angiogenetic, immunomodulatory and neuroprotective effects through binding to glucocorticoid receptors. Triamcinolone can relieve several dermatitis, immune diseases and ocular diseases .

HY-N10535

Lewis y tetrasaccharide Lewis y	Structural Classification Polysaccharides Classification of Application Fields Endogenous metabolite Disease Research Fields Saccharides Cancer	FAK
Lewis Y tetrasaccharide (Lewis Y, Le ^Y) is a tetrasaccharide derivative form of Lewis X trisaccharide (HY-N10534). Lewis Y tetrasaccharide is an antigen associated with malignant ovarian carcinomas metastasis and poor prognosis .

HY-N7575

Lacto-N-fucopentaose II LNFP II	Polysaccharides Classification of Application Fields Disease markers Metabolic Disease Endogenous metabolite Disease Research Fields Saccharides Cancer Source Classification	Endogenous Metabolite
Lacto-N-fucopentaose II (LNFP II) is a sialyl-Lewis, hapten of human Lewis bloodgroup determinant. Lacto-N-fucopentaose II monosialo-ganglioside/glycolipid and sialyl derivative, CA 19-9, is a molecular tumour markers (TM) for biliopancreatic malignancy .

HY-N0120

(E/Z)-Polydatin (E/Z)-Piceid	Structural Classification Stilbenes Classification of Application Fields Polygonaceae Reynoutria japonica Houtt. Phenols Polyphenols Plants Inflammation/Immunology Disease Research Fields Source Classification	Drug Isomer
(E/Z)-Polydatin ((E/Z)-Piceid) is a mixture of the E/Z configurations of Polydatin (HY-N0120A). Polydatin can be isolated from Polygonum cuspidatum, grapes, peanuts, red wine, hop pellets, cocoa-containing products and chocolate products. Polydatin exhibits multiple biological properties, such as anti-platelet aggregation, anti-low-density lipoprotein oxidation, cardioprotective activity, anti-inflammatory and immunomodulatory functions. Polydatin shows favorable cytotoxic effects against various tumor cell lines, including cervical cancer cells, liver cancer cells, and nasopharyngeal carcinoma cells .

HY-13718

Oglufanide H-Glu-Trp-OH; L-Glutamyl-L-tryptophan	Cardiovascular Disease Classification of Application Fields Animals Ketones, Aldehydes, Acids Endogenous metabolite Inflammation/Immunology Disease Research Fields Source Classification	VEGFR HCV Endogenous Metabolite
Oglufanide (H-Glu-Trp-OH) is a dipeptide immunomodulator isolated from calf thymus. Oglufanide inhibits vascular endothelial growth factor (VEGF). Oglufanide can stimulate the immune response to hepatitic C virus (HCV) and intracellular bacterial infections. Oglufanide shows antitumor and anti-angiogenesis activities .

HY-N10534

Lewis X trisaccharide Lewis X	Infection Structural Classification Polysaccharides Animals Classification of Application Fields Inflammation/Immunology Disease Research Fields Saccharides Cancer	Parasite
Lewis X trisaccharide (Lewis X, Le ^x) is a potent T_H2 regulator, antagonizes LPS-induced IL-12 immune expression. Lewis X trisaccharide is a human histo-blood group antigen, plays an key role in cell-cell adhesion, and servers as a tumor marker. Lewis X trisaccharide is highly expressed in the outer membrane of the parasite, can be used for the immunology research of schistosomiasis .

HY-N10531

Lewis a trisaccharide Lewis a	Structural Classification Polysaccharides Animals Classification of Application Fields Other Diseases Disease Research Fields Saccharides	Others
Lewis a trisaccharide (Lewis a) is a trisaccharide that has been found to be present in the glycan structures of spermatozoa. Lewis a trisaccharide also is a major component of the glycan structures on the surface of HL-60 cells .

HY-W145535

*Sialyl lewis* x-lactose**	Natural Products Classification of Application Fields Other Diseases Endogenous metabolite Disease Research Fields Source Classification	Biochemical Assay Reagents Endogenous Metabolite
Sialyl Lewis X-Lactose is a biochemical reagent that can be used as a biological material or organic compound for life science related research.

HY-125443

Lucialdehyde A	Triterpenes Microorganisms Terpenoids Source Classification	Others
Lucialdehydes A is a lanostante-type triterpene aldehydes, isolated from the fruiting bodies of Ganoderma lucidum. Lucialdehydes A shows cytotoxic effects on tumor cells, including Lewis lung carcinoma (LLC), T-47D, Sarcoma 180, and Meth-A tumor cell lines .

HY-108164

Aspidin BB	Dryopteridaceae Dryopteris championii (Benth.) C. Chr. Plants Source Classification	Apoptosis Bcl-2 Family Caspase
Aspidin BB is a phloroglucinol derivative, which can be isolated from the aerial part of Dryopteris championii. Aspidin BB has anticancer activity. Aspidin BB induces cell cycle arrest and apoptosis in human ovarian HO-8910 cells .

HY-N11455

Lacto-N-difucohexaose I LDFH I	Polysaccharides Microorganisms Saccharides Source Classification	Others
Lacto-N-difucohexaose I (LNDFH I), a linker, could be used to combine oligosaccharides containing Lewis b sugar chain to water insoluble polysaccharide .

HY-125664

Lucialdehyde B	Triterpenes Microorganisms Classification of Application Fields Terpenoids Disease Research Fields Cancer	Antibiotic
Lucialdehyde B is a tetracyclic triterpene isolated from the substrates of Ganoderma lucidum with antiviral and cytotoxic activities. Lucialdehyde B has cytotoxic effects against Lewis lung cancer (LLC), T-47D, Sarcoma 180 and Meth-A tumor cell lines .

HY-N12918

Lewis X tetrasaccharide	Polysaccharides Animals Saccharides Source Classification	Others
Lewis X tetrasaccharide is a cell surface glycan that can be used for diagnosis of microbial infections.

HY-126854R

N-Acetyllactosamine (Standard) N-Acetyl-D-lactosamine (Standard)	Structural Classification Natural Products Microorganisms	Reference Standards Endogenous Metabolite Galectin
N-Acetyllactosamine (Standard) is the analytical standard of N-Acetyllactosamine. This product is intended for research and analytical applications. N-Acetyllactosamine (N-Acetyl-D-lactosamine), a nitrogen-containing disaccharide, is a galectin-3 inhibitor, which is an important component of various oligosaccharides such as glycoproteins and sialyl Lewis X. N-Acetyllactosamine can be used as the starting material for the synthesis of various oligosaccharides. N-Acetyllactosamine has prebiotic effects[1][2][3][4].

HY-165394

Melafolone	Structural Classification Natural Products Polygonaceae Adiantum venustum Don Plants Source Classification	COX EGFR PD-1/PD-L1 PI3K Akt
Melafolone is a potent dual COX-2/EGFR inhibitor with IC₅₀s of 13.2 μM (COX-2) and 17.4 μM (EGFR). Melafolone enhances the effect of anti-PD-1 through vascular normalization and PD-L1 downregulation via the PI3K/Akt pathway in Lewis lung carcinoma (LLC) and CMT167 models. Melafolone can be used for lung cancer research .

HY-125871

Neopatulin	Human Gut Microbiota Metabolites Microorganisms Endogenous metabolite Source Classification	Biochemical Assay Reagents
Neopatulin is a redox isomer and pivotal biogenetic precursor of the potent antibiotic patulin, which is produced by numerous fungal species. Neopatulin can be synthesized through Lewis acid-catalyzed aldol reaction or 2-formyl-1,3-dithiane with 2-(tert-butyldimethylsiloxy)-4-[(tert-butyldimethylsiloxy)-methyl]furan .

Cat. No.	Product Name	Chemical Structure

HY-129630S

Tetrahydrocortisol-d5
Tetrahydrocortisol-d₅ is the deuterium labeled Tetrahydrocortisol. Tetrahydrocortisol is a cortisol metabolite that inhibits dexamethasone-induced formation of cross-linked actin networks. Tetrahydrocortisol can be used in the research of primary open-angle glaucoma, glucocorticoid-induced ocular hypertension, Lewis lung carcinoma, and EMT-6 mouse breast cancer .

Cat. No.	Product Name		Classification

HY-146245

ODN 1826 5+ Cited Publications CpG 1826		CpG ODNs
ODN 1826 is a class B CpG ODN (oligodeoxynucleotide) and TLR9 agonist. ODN 1826 induces NO and iNOS production and enhances Apoptosis. ODN 1826 enhances immune surveillance. ODN 1826 increases aortic atherosclerotic plaque size. ODN 1826 has antitumor activity against lung cancer, glioma and melanoma .

HY-146245C

ODN 1826 sodium 5+ Cited Publications CpG 1826 sodium		CpG ODNs
ODN 1826 sodium is a class B CpG ODN (oligodeoxynucleotide) and TLR9 agonist. ODN 1826 sodium induces NO and iNOS production and enhances Apoptosis. ODN 1826 sodium enhances immune surveillance. ODN 1826 sodium increases aortic atherosclerotic plaque size. ODN 1826 sodium has antitumor activity against lung cancer, glioma and melanoma .

HY-167036

DMG-PEG2000-Mal		Pegylated Lipids
DMG-PEG2000-Mal is a pegylated lipid with a molecular weight of 2000. DMG-PEG-Mal serves as a component of lipid nanoparticles for mRNA delivery .

HY-160047

AX102 sodium		Aptamers
AX102 sodium is a 34 bp length nucleotide aptamer modified at the 5' end with a 40 kDa polyethylene glycol moiety. AX102 selectively binds platelet-derived growth factor B (PDGF-B) and causes tumor vessel regression .

HY-160048

PEG40K unconjugated/naked AX102 sodium		Aptamers
PEG40K unconjugated/naked AX102 sodium is AX102 without PEG40K conjugation. AX102 is a DNA oligonucleotide aptamer for platelet-derived growth factor PDGF-B. AX102 is 34 bases in length, selectively binds platelet-derived growth factor B (PDGF-B), and causes tumor vessel regression .

Inquiry Online

Your information is safe with us. * Required Fields.

MCE Japan Authorized Agent ナミキ商事株式会社コスモ・バイオ株式会社重松貿易株式会社
Salutation			Country or Region *
Applicant Name *			Organization Name *
Department *
Email Address *			Product Name *
Cat. No.			Requested quantity *
Phone Number *
Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent:

Lewis

Inhibitors & Agonists

Screening Libraries

Fluorescent Dye

Biochemical Assay Reagents

Peptides

Inhibitory Antibodies

NaturalProducts

Isotope-Labeled Compounds

Oligonucleotides

Natural
Products