country

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P5790

Copy Link Print Information

μ-TRTX-Hd1a

μ-TRTX-Hd1a, a spider venom, is a selective NaV 1.7 inhibitor. μ-TRTX-Hd1a is a gating modifier that inhibits human NaV 1.7 by interacting with the S3b-S4 paddle motif in channel domain II.

For research use only. We do not sell to patients.

Formula: C₁₆₀H₂₄₆N₄₆O₅₁S₆
Molecular Weight:3822.33

Storage:

Please store the product under the recommended conditions in the Certificate of Analysis.

μ-TRTX-Hd1a Chemical Structure

Size

Price

Stock

Quantity

Sample (0.1mg)

In-stock

(In Japan)

Apply Now

Get Quote Ask For Quote & Lead Time Consult sales personnel for more information Check price and availability Get Quote Ask For Quote & Lead Time Consult sales personnel for more information Check price and availability

Bulk Inquiry

Amount: USD 0.00

* Please select Quantity before adding items.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity

Description

μ-TRTX-Hd1a, a spider venom, is a selective NaV 1.7 inhibitor. μ-TRTX-Hd1a is a gating modifier that inhibits human NaV 1.7 by interacting with the S3b-S4 paddle motif in channel domain II^[1].

All Sodium Channel Isoforms :

Chemical Information

Molecular Weight 3822.33
Formula C₁₆₀H₂₄₆N₄₆O₅₁S₆
Sequence

Ala-Cys-Leu-Gly-Phe-Gly-Lys-Ser-Cys-Asn-Pro-Ser-Asn-Asp-Gln-Cys-Cys-Lys-Ser-Ser-Ser-Leu-Ala-Cys-Ser-Thr-Lys-His-Lys-Trp-Cys-Lys-Tyr-Glu-Leu (Disulfide bridge:Cys2-Cys17;Cys9-Cys24;Cys16-Cys31)
Sequence Shortening

ACLGFGKSCNPSNDQCCKSSSLACSTKHKWCKYEL (Disulfide bridge:Cys2-Cys17;Cys9-Cys24;Cys16-Cys31)
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (260 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. Julie K Klint, et al. Seven novel modulators of the analgesic target NaV 1.7 uncovered using a high-throughput venom-based discovery approach. Br J Pharmacol. 2015 May;172(10):2445-58. [Content Brief]

Calculators

Molarity Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Dilution Calculator

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

100 mg

Get Quote In-stock