Be Alert: Fraudsters may impersonate MedChemExpress on social media or messaging platforms. Do not share personal, business, or payment information. Verify all representatives and payment instructions through MedChemExpress.com.

Master of Bioactive Molecules

Structure
Search

Recent Search:
  • Recent Search:
  • 222
  • EN - English
  • FR - Français
  • DE - Deutsch
  • ES - Español
  • JA - 日本語
  • KO - 한국어
country
Recent Search:

Change Language

Country or Region:

  • United States
Sign in
Cart
Product Name
Size / Unit Price
Qty
Total: USD 0.00 Checkout
  • United States
  • Products
  • Signaling Pathways
  • Recombinant Proteins
  • One-stop Drug Screening
  • Disease Areas
  • Kits
  • Resources
  • Services
  • Existing Quote | Contact Us
  • Products
  • Signaling Pathways
  • Recombinant Proteins
  • One-stop Drug Screening
  • Disease Areas
  • Kits
  • Resources
  • Services
  • Promotions
  • Existing Quote
  • Contact Us
  • Products
  • One-stop Drug Screening
  • Disease Areas
  • Research Areas
  • Services
  • Resources
  • Promotions
  • Contact Us
    • [email protected]
      609-228-6898
    Find Your Local Distributor
  • MCE Signaling Pathways
  • Recombinant Proteins
  • Kits
  • Antibody-Drug Conjugates (ADCs)
  • Oligonucleotides
  • Isotope-Labeled Compounds
  • Natural Products
  • Fluorescent Dyes
  • Peptides
  • Inhibitory Antibodies
  • Biochemical Assay Reagents
  • Antibodies
  • Enzymes
  • Reference Standards
  • Induced Disease Models Products
  • GMP Small Molecules
  • Click Chemistry
  • Adjuvants
  • Lipids
  • Saccharides
  • Preclinical Formulations
  • Compound Screening Libraries
  • Screening Technology and Services
  • Virtual Screening
  • Lead Optimization
  • Equipment and Consumables
  • Customized Compound Library
  • Cancer
  • Infection
  • Neurological, Eye or Ear Disease
  • Inflammation or Immune System Disease
  • Blood or Cardio-cerebrovascular Disease
  • Metabolic or Endocrine Disease
  • Respiratory Disease
  • Digestive System Disease
  • Urogenital Disease
  • Musculoskeletal and Skin Disease
  • Others
  • Cancer
  • Cardiovascular Disease
  • Endocrinology
  • Infection
  • Inflammation/Immunology
  • Metabolic Disease
  • Neurological Disease
  • Others
  • Custom Synthesis Services
  • Antibody Customization Services
  • One-stop Compound Screening Platform
  • Analytical Testing Services
  • One-stop CDMO Services
  • Quality Management System
  • Calculator Application
  • Scientific Reviews
  • Topics
  • Product Guides
  • Blogs
  • Protocols
  • Brochures
  • Events and Webinars
  • Genes
  • Anti-infection
  • Antibody-Drug Conjugate/ADC Related
  • Apoptosis
  • Autophagy
  • Cell Cycle/DNA Damage
  • Cytoskeleton
  • Epigenetics
  • GPCR/G Protein
  • Immunology/Inflammation
  • JAK/STAT Signaling
  • MAPK/ERK Pathway
  • Membrane Transporter/Ion Channel
  • Metabolic Enzyme/Protease
  • Neuronal Signaling
  • NF-κB
  • PI3K/Akt/mTOR
  • PROTAC
  • Protein Tyrosine Kinase/RTK
  • Stem Cell/Wnt
  • TGF-beta/Smad
  • Vitamin D Related/Nuclear Receptor
  • Others
  • More...
  • Cytokines and Growth Factors
  • Immune Checkpoint Proteins
  • CAR-T Related Proteins
  • CD Antigens
  • Fc Receptors
  • Receptor Proteins
  • Enzymes & Regulators
  • Kinases
  • Complement System
  • Ubiquitin Related Proteins
  • Viral Proteins
  • Biotinylated Proteins
  • Fluorescent-labeled Recombinant Proteins
  • GMP-grade Proteins
  • Animal-free Recombinant Proteins
  • Isotope-Labeled Recombinant Proteins
  • Others
  • More...
  • Molecular Biology
  • Nucleic Acid Gel Electrophoresis
  • Vector Construction
  • Restriction Endonuclease
  • Materials
  • PCR & qPCR
  • RT-PCR
  • Sequencing
  • Protein Biology
  • Protein Sample Preparation
  • Protein Purification
  • Protein Electrophoresis & WB
  • Multiple Fluorescent Staining
  • Immunoassay
  • Immunoprecipitation Kit
  • Labeling Kit
  • Cell Biology
  • Cell Culture
  • Cell Analysis
  • 3D Cell Culture
  • Cell Isolation
  • Biological Laboratory Consumables
  • Sample Storage
  • More...
  • ADC Antibodies
  • ADC Linkers
  • ADC Payloads
  • Antibody-Drug Conjugates (ADCs)
  • Antibody-Oligonucleotide Conjugates (AOCs)
  • Drug-Linker Conjugates for ADC
  • Peptide-Drug Conjugates (PDCs)
  • PROTAC-Linker Conjugates for PAC
  • Radionuclide-Drug Conjugates (RDCs)
  • ADC-Related Custom Services
  • Custom Peptide Synthesis
  • AI-Powered Peptide Design Service
  • Oligonucleotide Synthesis
  • Lipid Nanoparticles (LNP) Encapsulation Service
  • Recombinant Antibody Expression Service
  • More...
  • MicroRNAs
  • saRNAs
  • siRNAs
  • Antisense Oligonucleotides
  • Aptamers
  • CpG ODNs
  • Decoy ODNs
  • Polymers
  • Phospholipids
  • Pegylated Lipids
  • Cationic Lipids & Ionizable Lipids
  • Cholesterol
  • Fluorescent Lipids
  • Liposomes & LNPs
  • Metal Nanoparticles
  • Conjugatable Lipids
  • Organ-Targeted Delivery
  • Nucleoside Analogs
  • Nucleotide Analogs
  • Phosphoramidites
  • mRNA
  • Adjuvant
  • Cap Analogs
  • Other mRNA related Products
  • Cosolvents
  • Sweetening Agents
  • Emulsifiers
  • Fillers
  • Thickeners
  • Liposomal Film-forming Agents
  • Antioxidants
  • Binders
  • Chelating Agents
  • Disintegrants
  • Flavoring Agents
  • Freeze-drying Protective Agents
  • Bases
  • pH Modifiers
  • Release-retarding Agents
  • Preservatives
  • Solubilizing Agents
  • Solvents
  • Surfactants
  • Suspending Agents
  • Other Pharmaceutical Excipients
  • More...
  • Deuterium (2H, D)
  • Carbon-13 (13C)
  • Nitrogen-15 (15N)
  • Oxygen-17&18 (17O & 18O)
  • Sulfur-34 ( 34S )
  • Boron-10 (10 B )
  • Metal Isotopes
  • Isotope-Labeled Inhibitors
  • Isotope-Labeled Vitamins
  • Isotope-Labeled Amino Acids & Peptides
  • Isotope-Labeled Fatty Acids
  • Isotope-Labeled Bile Acids
  • Isotope-Labeled Steroids
  • Isotope-Labeled Metabolites
  • Isotope-Labeled Nucleic Acids
  • Isotope-Labeled Environmental Contaminants
  • Isotope-Labeled Synthetic Intermediates
  • Isotope-Labeled Polymers
  • Isotope-Labeled Fluorescent Dyes
  • Isotope-Labeled Recombinant Proteins
  • Multi-Isotope Internal Standardization
  • Deuterated OLED Materials
  • Other Isotope-Labeled Compounds
  • Hot Research Area
  • Internal Standard for Clinical Mass Spectrometry
  • Internal Standard for Food
  • Internal Standard for Pesticides & Veterinary Medicine
  • Internal Standard for Environmental Contaminants
  • More...
  • Alkaloids
  • Saccharides
  • Flavonoids
  • Terpenoids
  • Quinones
  • Phenylpropanoids
  • Steroids
  • Stilbenes
  • Phenols
  • Ketones, Aldehydes, Acids
  • Antibiotics
  • Cyclopeptides
  • Amino acids
  • Polymer products
  • Glucosinolates
  • Lipids
  • Peptides
  • Extract
  • Others
  • Plants
  • Animals
  • Microorganisms
  • Minerals
  • Endogenous metabolite
  • Marine natural products
  • Disease Research Fields
  • Food Research
  • Cosmetic Research
  • Research of Health Products
  • Agricultural Research
  • More...
  • Cell Staining Analysis
  • In Vivo Imaging
  • Biological Conjugation
  • Fluorogenic Substrate
  • Labeling Chemistry
  • Biology Analysis
  • Histological Analysis
  • Fluorescence Wavelength ranges
  • Celluar Organelle Dyes
  • Ion Fluorescent Indicators
  • Cell Behavior analysis Probes
  • Fluorescent Label
  • Live-animal imaging
  • Histological Staining
  • More...
  • Peptide and Derivatives
  • Antimicrobial Peptides
  • β-Amyloid and Tau Peptides
  • Cell-adhesion Peptides
  • Cosmetic Peptides
  • Hormones and Neuropeptides
  • Inhibitors and Substrates
  • Labeled Peptides
  • Peptide Epitopes
  • Peptides for Drug Delivery
  • Therapeutic Peptides
  • Peptidomimetics
  • Others
  • Reagents for Peptide Synthesis
  • Amino acids and Derivatives
  • Peptide Fragments
  • Resins
  • More...
  • Biosimilar Antibodies
  • Fusion Proteins
  • Isotype Control Antibodies
  • In Vivo Antibodies
  • Functional Proteins
  • Agonist Antibodies
  • Virus Neutralizing Antibodies
  • T cell engager (TCE)
  • Nanobodies
  • ADCC Enhanced Antibodies
  • Other
  • More...
  • Cell Assay Reagents
  • Enzyme Substrates
  • Thickeners
  • Co-solvents
  • Filter Medium
  • Buffer Reagents
  • Surfactants
  • Indicators
  • 3D Bioprinting
  • Carbohydrates
  • Gene Sequencing and Synthesis
  • Microbial Culture
  • Drug Delivery
  • Native Proteins
  • Chelators
  • Others
  • More...
  • Primary Antibodies
  • Monoclonal Antibodies
  • Polyclonal Antibodies
  • Recombinant Antibodies
  • Flow Cytometry Antibodies
  • Loading Controls Antibodies
  • Tag Antibodies
  • Modification Specific Antibodies
  • Small-molecule Compounds Antibodies
  • Conjugated Primary Antibodies
  • Nanobodies
  • Isotype Control Antibodies
  • Anti-payload Antibodies
  • Anti-idiotypic Antibodies
  • Secondary Antibodies
  • Fluorescent Conjugated Secondary Antibodies
  • Enzyme and Protein Conjugated Secondary Antibodies
  • Minimum Cross-reaction Secondary Antibodies
  • Spatial Conformation Specific Secondary Antibodies
  • Fragment Specific Secondary Antibodies
  • Light or Heavy Chain Specific Secondary Antibodies
  • Non-conjugated Secondary Antibodies
  • Ready to use Secondary Antibodies
  • Other Conjugated Secondary Antibodies
  • More...
  • Glycobiology Enzymes
  • Disease Research Enzymes
  • Biochemical Detection Enzymes
  • Tissue Dissociation Enzyme
  • Nuclease
  • Protease
  • Tool Enzyme
  • Coenzymes and Others
  • Extract
  • Recombinant
  • Chemical Synthesis
  • Immobilized Enzyme
  • Ammonium Sulfate Suspension
  • More...
  • Natural Product Standards
  • Lipid Standards
  • Pesticide Standards
  • Metabolism Standards
  • Cosmetic Testing Standards
  • Drug Testing Standards
  • Food Testing Standards
  • Other Standards
  • Medicine Food Homology
  • FDA-approved Drugs
  • Standards included in the ChP
  • Standards included in the USP-NF
  • More...
  • Cancer Models
  • Endocrine and Metabolic Disease Models
  • Immunology and Inflammatory Disease Models
  • Nervous System Disease Models
  • Cardiovascular System Disease Models
  • Digestive System Disease Models
  • Respiratory System Disease Models
  • Urinary System Disease Models
  • Five Sense Organs Disease Models
  • Genetically Engineered Disease Models
  • Skin Disease Models
  • Reproductive System Disease Models
  • More...
  • GMP Molecules for Cell and Gene Therapy (CGT)
  • GMP Small molecules for Antibody-drug Conjugate(ADC)
  • More...
  • Azide
  • Alkynes
  • DBCO
  • TCO
  • Tetrazine
  • BCN
  • ADC Synthesis
  • PROTAC Synthesis
  • Labeling and Fluorescence Imaging
  • More...
  • Emulsion Adjuvants Mineral Salt Adjuvants Monophosphory Lipid A Adjuvants Nucleic Acid Adjuvants
  • CpG ODNs
  • Cyclic Dinucleotides
  • Double-stranded DNAs
  • Saponin Adjuvants Targeted Pattern Recognition Receptor-Type Adjuvants
  • STING Adjuvants
  • TLR Adjuvants
  • cGAS Adjuvants
  • More...
  • Docosanoids
  • Eicosanoids
  • Fatty Acids
  • Fatty Alcohols
  • Fatty Aldehydes
  • Fatty Amides
  • Fatty Esters
  • Fatty Ethers
  • Fatty Nitriles
  • Glycerolipids
  • Glycerophospholipids
  • Hydrocarbons
  • Octadecanoids
  • Oxygenated Hydrocarbons
  • Polyketides
  • Prenol Lipids
  • Saccharolipids
  • Sphingolipids
  • Sterol Lipids
  • Fatty Acyl Glycosides
  • Other Fatty Acyls
  • Fluorescent Lipids
  • GMP Lipids
  • Isotope-Labeled Lipids
  • Lipid Standards
  • Lipids In Drug Delivery
  • Lipid Metabolites
  • More...
  • Glycosides
  • Monosaccharides
  • Reducing Sugars
  • Disaccharides
  • Oligosaccharides
  • Polysaccharides
  • Glycolipids
  • Glycopeptides
  • Nucleosides & Nucleotides
  • Lipopolysaccharides
  • Blood Group Saccharides
  • Cosmetic Research
  • Functional Qligosaccharides and Polysaccharides
  • Glyco Building Blocks
  • Isotope-Labeled Saccharides
  • Medical Materials Research
  • Saccharides Standards
  • Surfactants
  • More...
  • Nanoparticles
  • Solution
  • Animal Diet
  • Cancer
  • Blood or Cardio-cerebrovascular Disease
  • Infection
  • Neurological, Eye or Ear Disease
  • Metabolic or Endocrine Disease
  • Respiratory Disease
  • Digestive System Disease
  • Inflammation or Immune System Disease
  • Urogenital Disease
  • Musculoskeletal and Skin Disease
  • Others
  • More...
  • Bioactive Compound Series
    General Bioactive Screening Libraries
    Drug Repurposing Series
    Metabolism Focused Libraries
    Signaling Pathway Targeting Libraries
    Disease Focused Libraries
    Structure Classified Libraries
    Compound Characteristic Classified Libraries
    Natural Products Series
    Natural Product Screening Libraries
    Traditional Chinese Medicine Libraries
    Structure Classified Natural Product Libraries
    Fragment Libraries
    Featured Fragment Libraries
    Functional Fragment Libraries
    According to Fragment Structures
    Diversity Compound Libraries
    Distinctive Diversity Libraries
    Focused and target libraries
    According to Lead-like Structures
    DNA Encoded Libraries
    AI-enabled Libraries
    • Cell-based Compound Screening
    • High-Content Screening
    • Ion Channel Screening
    • Kinase Screening Services
    • Surface Plasmon Resonance (SPR) Assay Services
    • Molecular Docking
    • Molecular Dynamics Simulation
    • GPCR Bioassay Screening Services
    • Nuclear Receptor Screening Services
    • Affinity Mass Spectrometry
    • DEL Synthesis and Screening
    • mRNA Display Technology
    • SPRi High Throughput Screening
    • AI Driven Drug Screening
    • Molecular Interaction Assay Services
    • Drug Target Identification Services
    • Computer-aided Reverse Target Identification
    • Network Pharmacology / Network Toxicology Analysis
    • Lung Cancer
    • Breast Cancer
    • Colorectal Cancer
    • Prostate Cancer
    • Gastric Cancer
    • Liver Cancer
    • Thyroid Cancer
    • Cervical Cancer
    • Bladder Cancer
    • Leukemia/Lymphoma/Myeloma
    • Pancreatic Cancer
    • Melanoma
    • Ovarian Cancer
    • Glioma
    • Neuroblastoma
    • Osteosarcoma
    • Viral Infection
    • Coronavirus Infection
    • HIV Infection
    • Hepatitis Virus Infection
    • Bacterial Infection
    • Fungal Infection
    • Parasitic Infection
    • Plant Infection
    • Neurodegenerative Disease
    • Cerebrovascular Disease
    • Schizophrenia
    • Depression
    • Epilepsy
    • Anxiety or Fear-Related Disease
    • Pain
    • Neurotrophic or Neurotoxic Disease
    • CNS Infection
    • CNS Neoplasm
    • Nervous System Injury
    • Attention Deficit Hyperactivity Disorder
    • Behavioral Addiction
    • Sleep-Wake Disorder
    • Visual System Disease
    • Ear Disease
    • Autoimmune Disease
    • Immunodeficiency Disease
    • Allergy
    • Cancer Immunology
    • Vaccine and Immunization
    • Immunomodulation
    • Skin Inflammation
    • Pathogens Infection
    • Oxidative Stress and Inflammation
    • Chronic Disease and Inflammation
    • Respiratory Inflammation
    • Digestive System Inflammation
    • Genitourinary Inflammation
    • Cerebrovascular Disease
    • Cardiovascular Disease
    • Blood Disease
    • Heart Disease
    • Glucose Metabolism
    • Lipid Metabolism
    • Amino Acid/Protein Metabolism
    • Mineral Metabolism
    • Purine Metabolism
    • Hypothalamic-Pituitary-Adrenal Regulation
    • Thyroid Disease
    • Gonadal Disease
    • Parathyroid Disease
    • Energy Metabolism
    • Dietary Supplement
    • Upper Respiratory Inflammation
    • Lower Respiratory Inflammation
    • Pulmonary Disease
    • Respiratory Cancer
    • Digestive System Cancer
    • Gastric Disease
    • Peptic Ulcer Disease
    • Liver Disease
    • Constipation
    • Urologic Disease
    • Renal Disease
    • Male Reproductive System Disease
    • Female Reproductive System Disease
    • Urogenital Cancer
    • Sexually Transmitted Disease
    • Arthritis
    • Spinal Disease
    • Muscle Disease
    • Osteogenic Differentiation
    • Skin Disease
    • Bulk and Custom Synthesis Services
    • ADC-Related Custom Services
    • PROTAC-Related Custom Services
    • Custom Reference Standard Products
    • Custom Peptide Synthesis
    • AI-Powered Peptide Design Service
    • Recombinant Protein Expression Services
    • Recombinant Antibody Expression Services
    • Protein Crystal Structure Elucidation
    • Oligonucleotide Synthesis
    • Lipid Nanoparticles (LNP) Encapsulation Service
    • Fluorescent Labeling Services
    • Custom Synthesis of Stable Isotope-Labeled Compounds
    • Rabbit Polyclonal Antibody Custom Services
    • Rabbit Monoclonal Antibody Custom Services
    • Mouse Monoclonal Antibody Custom Services
    • One-Stop Drug Screening Platform
    • Virtual Screening
    • AI Driven Drug Screening
    • Molecular Docking
    • Molecular Dynamics Simulation
    • Surface Plasmon Resonance (SPR) Assay Services
    • Molecular Interaction Assay Services
    • DEL Synthesis and Screening
    • mRNA Display Technology
    • Affinity Mass Spectrometry
    • SPRi High Throughput Screening
    • Cell-based Compound Screening
    • High-Content Screening
    • GPCR Bioassay Screening Services
    • Kinase Screening Services
    • Ion Channel Screening
    • Nuclear Receptor Screening Services
    • Drug Target Identification Services
    • Lead Optimization
    • Biological Macromolecule Drug Testing Services
    • Small Molecule Chemical Drug Testing Services
    • Molarity Calculator
    • Dilution Calculator
    • Density Calculator
    • Reconstitution Calculator
    • Specific Activity Calculator
    • Protein Sequence Alignment Tool
    • Protein pI, MW and Extinction Coefficient Calculator
    • DNA Sequence Alignment Tool
    • DNA/RNA Sequence Conversion Tool
    • DNA Molecular Weight Calculator
    • MCE Signaling Pathways
    • Recombinant Proteins
    • One-Stop Drug Screening Platform
    • Kits
    • Antibody-Drug Conjugates (ADCs)
    • Oligonucleotides
    • Isotope-Labeled Compounds
    • Natural Products
    • Fluorescent Dyes
    • Peptides
    • Inhibitory Antibodies
    • Biochemical Assay Reagents
    • Antibodies
    • Enzymes
    • Reference Standards
    • Induced Disease Models Products
    • GMP Small Molecules
    • Click Chemistry
    • Adjuvants
    • Lipids
    • Saccharides
    • Preclinical Formulations
    • Research Areas
      • Cancer
      • Cardiovascular Disease
      • Endocrinology
      • Infection
      • Inflammation/Immunology
      • Metabolic Disease
      • Neurological Disease
      • Others
    • Anti-infection
    • Antibody-Drug Conjugate/ADC Related
    • Apoptosis
    • Autophagy
    • Cell Cycle/DNA Damage
    • Cytoskeleton
    • Epigenetics
    • GPCR/G Protein
    • Immunology/Inflammation
    • JAK/STAT Signaling
    • MAPK/ERK Pathway
    • Membrane Transporter/Ion Channel
    • Metabolic Enzyme/Protease
    • Neuronal Signaling
    • NF-κB
    • PI3K/Akt/mTOR
    • PROTAC
    • Protein Tyrosine Kinase/RTK
    • Stem Cell/Wnt
    • TGF-beta/Smad
    • Vitamin D Related/Nuclear Receptor
    • Others
    • Antibiotic
    • Arenavirus
    • Bacterial
    • Beta-lactamase
    • CHIKV
    • CMV
    • Dengue Virus
    • EBV
    • Endoplasmic Reticulum Oxidoreductase 1 (ERO1)
    • Enterovirus
    • Filovirus
    • Flavivirus
    • Fungal
    • HBV
    • HCV
    • HCV Protease
    • Hepatitis E Virus (HEV)
    • HIV
    • HIV Protease
    • HPV
    • HSV
    • Influenza Virus
    • Measles Virus
    • Orthopoxvirus
    • Parasite
    • Penicillin-binding protein (PBP)
    • RABV
    • Reverse Transcriptase
    • RSV
    • SARS-CoV
    • TMV
    • Tomato Spotted Wilt Virus (TSWV)
    • Urease
    • Virus Protease
    • VRK
    • VSV
    • VZV
    • More...
    • ADC Antibodies
    • ADC Linkers
    • ADC Payloads
    • Antibody-Drug Conjugates (ADCs)
    • Antibody-Oligonucleotide Conjugates (AOCs)
    • Drug-Linker Conjugates for ADC
    • Peptide-Drug Conjugates (PDCs)
    • PROTAC-Linker Conjugates for PAC
    • Radionuclide-Drug Conjugates (RDCs)
    • More...
    • 14-3-3 Protein
    • Apoptosis
    • ASK1
    • Bcl-2 Family
    • c-Myc
    • Caspase
    • Cuproptosis
    • DAPK
    • Ferroptosis
    • FKBP
    • Glutathione Peroxidase
    • IAP
    • MDM-2/p53
    • Necroptosis
    • PANoptosis
    • Paraptosis
    • Photosensitizer
    • PKD
    • Pyroptosis
    • RIP kinase
    • Survivin
    • Thymidylate Synthase
    • TNF Receptor
    • Transferrin Receptor
    • More...
    • 14-3-3 Protein
    • Atg4
    • Atg7
    • Atg8/LC3
    • ATTECs
    • AUTACs
    • Autophagy
    • Beclin1
    • ER-phagy
    • FKBP
    • LRRK2
    • Mitophagy
    • p62
    • PINK1/Parkin
    • ULK
    • More...
    • Antifolate
    • APC
    • ATF6
    • ATM/ATR
    • Aurora Kinase
    • Casein Kinase
    • CDK
    • CDKL
    • Checkpoint Kinase (Chk)
    • ClpP
    • Cyclin G-associated Kinase (GAK)
    • Deubiquitinase
    • Disulfidptosis
    • DNA Alkylator/Crosslinker
    • DNA Stain
    • DNA-PK
    • DNA/RNA Synthesis
    • Early 2 Factor (E2F)
    • Endonuclease
    • Eukaryotic Initiation Factor (eIF)
    • Eukaryotic Release Factor (eRF)
    • FKBP
    • Folate Receptor (FR)
    • G-quadruplex
    • Haspin Kinase
    • HDAC
    • HMG Family
    • HOXA
    • HSP
    • IRE1
    • Kinesin
    • LIM Kinase (LIMK)
    • MARK
    • MASTL
    • Microphthalmia Associated Transcription Factor (MITF)
    • Microtubule/Tubulin
    • Microtubule‐associated serine/threonine kinase (MAST)
    • Mitosis
    • Mps1
    • NEKs
    • Nucleoside Antimetabolite/Analog
    • p97
    • PAK
    • PARP
    • PDI
    • PERK
    • Polo-like Kinase (PLK)
    • Poly(ADP-ribose) Glycohydrolase (PARG)
    • PPAR
    • RAD51
    • ROCK
    • Separase
    • Sirtuin
    • SRPK
    • STK33
    • SWI/SNF Complex
    • Telomerase
    • TLK
    • TOPK
    • Topoisomerase
    • Wee1
    • YB-1
    • Zinc Finger Protein
    • More...
    • Actin
    • Annexin A
    • Arp2/3 Complex
    • Cadherin
    • Calpain
    • Cdc42-binding kinase
    • Cellulose Synthase
    • Clathrin
    • Claudin
    • Collagen
    • Connexin
    • Dynamin
    • Dystrophin
    • Exosomes
    • Gap Junction Protein
    • Integrin
    • Kinesin
    • Lysyl Oxidase
    • MARCKS
    • MASTL
    • Microtubule/Tubulin
    • Mps1
    • Myosin
    • PAK
    • ROCK
    • SLK
    • Tissue Factor Pathway Inhibitor (TFPI)
    • More...
    • AMPK
    • Aurora Kinase
    • DNA Glycosylase
    • DNA Methyltransferase
    • Epigenetic Reader Domain
    • Glycosyltransferase
    • HDAC
    • Histone Acetyltransferase
    • Histone Demethylase
    • Histone Methyltransferase
    • hnRNP
    • HuR
    • JAK
    • Methionine Adenosyltransferase (MAT)
    • METTL3
    • MicroRNA
    • PARP
    • PKC
    • Protein Arginine Deiminase
    • RNA MTase
    • S-adenosylhomocysteine hydrolase (SAHH)
    • SF3B1
    • Sirtuin
    • Small Interfering RNA (siRNA)
    • TET Protein
    • WDR5
    • YTHDF
    • More...
    • 5-HT Receptor
    • Adenylate Cyclase
    • Adhesion G Protein-coupled Receptors (AGPCRs)
    • Adrenergic Receptor
    • Amylin Receptor
    • Angiotensin Receptor
    • Apelin Receptor (APJ)
    • Arf Family GTPase
    • Arrestin
    • Bombesin Receptor
    • Bradykinin Receptor
    • Cannabinoid Receptor
    • CaSR
    • CCR
    • CGRP Receptor
    • Chemerin Receptor
    • Cholecystokinin Receptor
    • CRFR
    • CXCR
    • EBI2/GPR183
    • Endothelin Receptor
    • Formyl Peptide Receptor (FPR)
    • Free Fatty Acid Receptor
    • G protein-coupled Bile Acid Receptor 1
    • G Protein-coupled Receptor Kinase (GRK)
    • G2A (GPR132)
    • GHSR
    • GLP Receptor
    • GnRH Receptor
    • GPR109A
    • GPR119
    • GPR139
    • GPR171
    • GPR35
    • GPR39
    • GPR4
    • GPR52
    • GPR55
    • GPR6
    • GPR65
    • GPR68
    • GPR84
    • GPR88
    • Guanylate Cyclase
    • Histamine Receptor
    • Hydroxycarboxylic Acid Receptor (HCAR)
    • ICMT
    • Kisspeptin Receptor
    • Leukotriene Receptor
    • LPL Receptor
    • mAChR
    • Mas-related G-protein-coupled Receptor (MRGPR)
    • MCHR1 (GPR24)
    • Melanocortin Receptor
    • Melanopsin Receptor
    • Melatonin Receptor
    • mGluR
    • Motilin Receptor
    • Natriuretic Peptide Receptor (NPR)
    • Neurokinin Receptor
    • Neuromedin U Receptor (NMUR)
    • Neuropeptide B/W Receptor
    • Neuropeptide FF Receptor
    • Neuropeptide S Receptor
    • Neuropeptide Y Receptor
    • Neurotensin Receptor
    • Olfactory Receptor
    • Opioid Receptor
    • Orexin Receptor (OX Receptor)
    • Orphan GPCR
    • Orphan Receptor
    • Oxytocin Receptor
    • P2Y Receptor
    • PACAP Receptor
    • Platelet-activating Factor Receptor (PAFR)
    • Prokineticin Receptor
    • Prostaglandin Receptor
    • Protease Activated Receptor (PAR)
    • PTHR
    • Ras
    • RGS Protein
    • RXFP Receptor
    • Secretin Receptor
    • Somatostatin Receptor
    • Succinate Receptor 1
    • Taste Receptor
    • Trace Amine-associated Receptor (TAAR)
    • TSH Receptor
    • Urotensin Receptor
    • Vasopressin Receptor
    • More...
    • AIM2
    • ALCAM/CD166
    • AP-1
    • Arginase
    • Aryl Hydrocarbon Receptor
    • Asialoglycoprotein Receptor (ASGPR)
    • BCL6
    • C-type Lectin-like Receptors (CTLRs)
    • CCR
    • CD1
    • CD19
    • CD2
    • CD20
    • CD22
    • CD276/B7-H3
    • CD28
    • CD3
    • CD38
    • CD44
    • CD47
    • CD6
    • CD73
    • CD74
    • Complement System
    • COX
    • CTLA-4
    • CX3CR1
    • CXCR
    • Cyclic GMP-AMP Synthase
    • Cyclophilin
    • DOCK
    • E-Selectin
    • FAP
    • Fc Receptor (FcR)
    • FKBP
    • FLAP
    • Free Radical Scavengers
    • Galectin
    • Glucocorticoid Receptor
    • Glycoprotein VI
    • Hapten
    • Histamine Receptor
    • Human leukocyte immunoglobulin (Ig)-like receptors (LILR)
    • IFNAR
    • IKZF Family
    • Interleukin Related
    • IRAK
    • Kallikrein
    • L-Selectin
    • LAG-3
    • LILRB
    • Macrophage migration inhibitory factor (MIF)
    • Mesothelin
    • MHC
    • Mucin
    • MyD88
    • Nectin-4
    • Ninjurin
    • NO Synthase
    • NOD-like Receptor (NLR)
    • NTPDase
    • Nuclear Factor of activated T Cells (NFAT)
    • Osteopontin
    • P-selectin
    • PD-1/PD-L1
    • PGE synthase
    • Programmed Cell Death 4 (PDCD4)
    • PSMA
    • Pyroptosis
    • Reactive Oxygen Species (ROS)
    • RIG-I-like receptor (RLR)
    • S100 Protein
    • Salt-inducible Kinase (SIK)
    • Scavenger Receptor Class B type I (SR-BI)
    • SOD
    • SphK
    • STING
    • Thrombopoietin Receptor
    • Tim3
    • Toll-like Receptor (TLR)
    • Transmembrane Glycoprotein
    • TREM receptor
    • TROP2
    • VAP-1
    • VISTA
    • More...
    • EGFR
    • Erythropoietin Receptor (EpoR)
    • JAK
    • Pim
    • STAT
    • More...
    • ABA Receptor
    • ERK
    • Erythropoietin Receptor (EpoR)
    • JNK
    • KLF
    • MAP3K
    • MAP4K
    • MAPKAPK2 (MK2)
    • MEK
    • Microtubule‐associated serine/threonine kinase (MAST)
    • Mixed Lineage Kinase
    • MNK
    • p38 MAPK
    • Raf
    • Ras
    • Ribosomal S6 Kinase (RSK)
    • SOS1
    • More...
    • Amino acid Transporter
    • Anion Exchangers
    • Apical Sodium-Dependent Bile Acid Transporter
    • Aquaporin
    • ASCT
    • ATP Synthase
    • ATP-binding cassette (ABC) transporters
    • BCRP
    • Calcium Channel
    • Calmodulin
    • CFTR
    • Chloride Channel
    • CRAC Channel
    • CRM1
    • EAAT
    • EHD Protein
    • FATP
    • Ferlin Family
    • Ferroportin
    • GABA Receptor
    • GLUT
    • Glycine Receptor (GlyR)
    • GlyT
    • HCN Channel
    • iGluR
    • Monoamine Transporter
    • Monocarboxylate Transporter
    • Na+/Ca2+ Exchanger
    • Na+/H+ Exchanger (NHE)
    • Na+/HCO3- Cotransporter
    • Na+/K+ ATPase
    • nAChR
    • NKCC
    • Nucleoside Transporters
    • OAT
    • Oligopeptide Cotransporter
    • P-glycoprotein
    • P2X Receptor
    • Piezo Channel
    • Potassium Channel
    • Proton Pump
    • Sec61
    • SGLT
    • SLC39 (Zinc Transporter)
    • Sodium Channel
    • Sodium Chloride Cotransporter (NCC)
    • Sodium Phosphate Cotransporter
    • Synaptic Vesicle Proteins
    • TRP Channel
    • URAT1
    • Urea Transporter
    • VDAC
    • WNK Kinase
    • More...
    • 11β-HSD
    • 15-PGDH
    • 17β-HSD
    • 20α-HSD
    • 3α-HSD
    • 3β-HSD
    • 5 alpha Reductase
    • Acetolactate Synthase (ALS)
    • Acetyl-CoA Carboxylase
    • Acetyl-CoA synthetase
    • ACSL Family
    • Acyltransferase
    • ADAMTS
    • Adiponectin Receptor
    • Aldehyde Dehydrogenase (ALDH)
    • Aldehyde Oxidase (AO)
    • Aldose Reductase
    • Amine N-methyltransferase
    • Amino Acid Oxidase
    • Aminoacyl-tRNA Synthetase
    • Aminopeptidase
    • Aminotransferases (Transaminases)
    • Amylases
    • Angiotensin-converting Enzyme (ACE)
    • ANGPTL
    • Apolipoprotein
    • Arginase
    • ATGL
    • ATP Citrate Lyase
    • Branched Chain Amino Acid Transaminase (BCAT)
    • BTB/POZ Family
    • Calpain
    • Carbamoyl Phosphate Synthetase (CPS)
    • Carbonic Anhydrase
    • Carbonyl Reductase
    • Carboxylesterase (CES)
    • Carboxypeptidase
    • Carnitine Palmitoyltransferase (CPT)
    • Carnosine-cleaving Enzyme
    • Cathepsin
    • Ceramidase
    • CETP
    • COMT
    • Creatine Kinase
    • Cryptochrome
    • Cytochrome P450
    • DAGL
    • Dehydrocholesterol Reductase (DHCR)
    • DGK
    • Dihydroceramide Desaturase 1 (DES1)
    • Dihydrofolate reductase (DHFR)
    • Dihydroorotate Dehydrogenase
    • Dihydropyrimidine Dehydrogenase (DPD)
    • Dipeptidyl Peptidase
    • Drug Metabolite
    • E1/E2/E3 Enzyme
    • Elastase
    • ELOVL
    • Emopamil Binding Protein
    • Endogenous Metabolite
    • Endothelin-Converting Enzyme (ECE)
    • Enolase
    • Enteropeptidase
    • Epoxide Hydrolase
    • FAAH
    • FABP
    • Factor VIIa
    • Factor VIII
    • Factor Xa
    • Factor XI
    • Farnesyl Transferase
    • FASTK
    • Fat Mass and Obesity-associated Protein (FTO)
    • Fatty Acid Synthase (FASN)
    • FBPase
    • Ferrochelatase
    • FOXA
    • FOXC
    • FOXJ
    • FOXM1
    • FOXO
    • FOXP
    • Fructose-1,6-bisphosphate aldolase
    • Furin
    • FXR
    • Galactokinase
    • GGTase
    • GHR
    • Glucokinase
    • Glucose-6-Phosphate Isomerase (GPI)
    • Glutamate Dehydrogenase (GLDH)
    • Glutaminase
    • Glutathione Peroxidase
    • Glutathione Reductase (GR)
    • Glutathione S-transferase
    • Glycolate Oxidase
    • Glycosidase
    • Glyoxalase (GLO)
    • GSNOR
    • HCV Protease
    • Heme Oxygenase (HO)
    • Hemoglobin
    • Hepcidin
    • Herbicide
    • Hexokinase
    • HIF/HIF Prolyl-Hydroxylase
    • HIV Integrase
    • HIV Protease
    • HMG-CoA Reductase (HMGCR)
    • Hormone-Sensitive Lipase (HSL)
    • HPPD
    • HRASLS
    • HSP
    • IDE
    • IMPDH
    • Indoleamine 2,3-Dioxygenase (IDO)
    • IPK Superfamily
    • Isocitrate Dehydrogenase (IDH)
    • Ketohexokinase
    • KMO
    • Lactate Dehydrogenase
    • LDLR
    • Lipase
    • Lipocalin Family
    • Liposome
    • Lipoxygenase
    • LOX-1
    • LXR
    • MAGL
    • Malate Dehydrogenase (MDH)
    • Malonyl-CoA Decarboxylase
    • MALT1
    • MetAP
    • Methionine Adenosyltransferase (MAT)
    • Methylenetetrahydrofolate Dehydrogenase (MTHFD)
    • Microsomal Triglyceride Transfer Protein (MTP)
    • Mineralocorticoid Receptor
    • Mitochondrial Metabolism
    • Mitogen- and Stress-Activated Protein Kinase (MSK)
    • MMP
    • Myotonin-Protein Kinase (DMPK)
    • N-myristoyltransferase
    • NADH Dehydrogenase
    • NADPH Oxidase
    • NAMPT
    • NEDD8-activating Enzyme
    • Neprilysin
    • Ornithine decarboxylase (ODC)
    • Oxidative Phosphorylation
    • Oxysterol-binding Protein-related Protein (ORP)
    • PAI-1
    • PANK
    • Pantetheinase
    • PASK/STK37
    • PCSK9
    • PDHK
    • PDI
    • PEPCK
    • Peroxidase Enzyme
    • PGC-1α
    • Phosphatase
    • Phosphodiesterase (PDE)
    • Phosphoglycerate Dehydrogenase (PHGDH)
    • Phosphoglycerate Kinase (PGK)
    • Phospholipase
    • Phosphomannose Isomerase (PMI)
    • Phosphorylase
    • Photosystem II
    • PI4P5K
    • PI5P4K
    • Plasminogen/Plasmin
    • PNPLA3
    • PPAR
    • Procollagen C Proteinase
    • Prolyl Endopeptidase (PREP)
    • Proteasome
    • Protein Prenyltransferase
    • Proteolytic Enzyme
    • Protoporphyrinogen IX oxidase
    • Pyruvate Carboxylase (PC)
    • Pyruvate Kinase
    • Quinone Reductase
    • RAR/RXR
    • Reactive Oxygen Species (ROS)
    • Renin
    • REV-ERB
    • RIO Kinase
    • ROR
    • RPE65
    • S-adenosylhomocysteine hydrolase (SAHH)
    • Ser/Thr Kinase
    • Ser/Thr Protease
    • Serine Racemase (SR)
    • Serpin
    • SGK
    • SHMT
    • Sialyltransferase
    • SnRK
    • SPFH Protein Superfamily
    • Squalene Monooxygenase
    • Stearoyl-CoA Desaturase (SCD)
    • Steroid Sulfatase
    • Succinate Dehydrogenase
    • SULT
    • Thrombin
    • TLK
    • TMPRSS6
    • Transglutaminase
    • Transketolase
    • TrxR
    • Tryptophan Hydroxylase
    • TSSK
    • Tyrosinase
    • Tyrosine Hydroxylase
    • UGT
    • Xanthine Oxidase
    • β-glucuronidase
    • γ-Glutamyl Transferase (GGT)
    • More...
    • 5-HT Receptor
    • AAK1
    • Adrenergic Receptor
    • Amino Acid Decarboxylase
    • Amyloid-β
    • Beta-secretase
    • Calcineurin
    • Calcium Channel
    • CaMK
    • Cannabinoid Receptor
    • CGRP Receptor
    • Cholecystokinin Receptor
    • Choline Kinase
    • Cholinesterase (ChE)
    • COMT
    • Dihydroceramide Desaturase 1 (DES1)
    • Dimethylargininase (DDAH)
    • FAAH
    • GABA Receptor
    • Glucosylceramide Synthase (GCS)
    • GlyT
    • GPR119
    • GPR139
    • GPR55
    • Histamine Receptor
    • Huntingtin
    • iGluR
    • Imidazoline Receptor
    • Legumain
    • mAChR
    • MCHR1 (GPR24)
    • Melanocortin Receptor
    • Melatonin Receptor
    • mGluR
    • Monoamine Oxidase
    • nAChR
    • Neurokinin Receptor
    • Neuropeptide Y Receptor
    • Neurotensin Receptor
    • Notch
    • OGA
    • OGT
    • Olfactory Receptor
    • OLIG2
    • Opioid Receptor
    • Orexin Receptor (OX Receptor)
    • PINK1/Parkin
    • Prion Protein
    • Serotonin Transporter
    • Sigma Receptor
    • Slit Proteins
    • Somatostatin Receptor
    • Tau Protein
    • Transthyretin (TTR)
    • Trk Receptor
    • TRP Channel
    • TSPO
    • α-synuclein
    • γ-secretase
    • More...
    • IKK
    • Keap1-Nrf2
    • MALT1
    • Microtubule‐associated serine/threonine kinase (MAST)
    • NF-κB
    • Pirin
    • RANKL/RANK
    • Reactive Oxygen Species (ROS)
    • More...
    • Akt
    • AMPK
    • ATM/ATR
    • DNA-PK
    • Erythropoietin Receptor (EpoR)
    • GSK-3
    • IPK Superfamily
    • MELK
    • Microtubule‐associated serine/threonine kinase (MAST)
    • mTOR
    • PDK-1
    • PI3K
    • PI4K
    • PIKfyve
    • PIN1
    • PTEN
    • More...
    • ATTECs
    • AUTACs
    • AUTOTACs
    • ByeTAC
    • DUBTACs
    • E3 Ligase Ligand-Linker Conjugates
    • Hsp-targeting Chimeras
    • HyT
    • Ligands for E3 Ligase
    • Ligands for Target Protein for PROTAC
    • LYTACs
    • Molecular Glues
    • PhosTACs
    • PROTAC Linkers
    • PROTAC-Linker Conjugates for PAC
    • PROTACs
    • Proteasome Cap Targeting Chimeras
    • PROTECs
    • RIBOTAC
    • SNIPERs
    • Target Protein Ligand-Linker Conjugates
    • More...
    • Ack1
    • Anaplastic lymphoma kinase (ALK)
    • Bcr-Abl
    • BMX Kinase
    • BRK
    • Btk
    • c-Fms
    • c-Kit
    • c-Met/HGFR
    • Discoidin Domain Receptor
    • DYRK
    • EGFR
    • Ephrin Receptor
    • FAK
    • FGFR
    • FLT3
    • GDNF Receptor
    • IGF-1R
    • Itk
    • JAK
    • PDGFR
    • Pyk2
    • RET
    • ROS Kinase
    • SHP1
    • SHP2
    • Src
    • Syk
    • TAM Receptor
    • Tie
    • TNK1
    • Trk Receptor
    • VEGFR
    • More...
    • BMI1
    • Casein Kinase
    • Connective Peptide
    • ERK
    • Gli
    • GSK-3
    • Hedgehog
    • Hippo (MST)
    • JAK
    • Large Tumor Suppressor (LATS)
    • Notch
    • Oct3/4
    • Organoid
    • PKA
    • PKG
    • Porcupine
    • ROCK
    • RUNX
    • SDCBP
    • sFRP-1
    • Smo
    • STAT
    • TGF-beta/Smad
    • Transcription Factor ERG
    • Wnt
    • YAP
    • β-catenin
    • γ-secretase
    • More...
    • Dan family
    • PKA
    • PKC
    • ROCK
    • RUNX
    • TGF-beta/Smad
    • TGF-β Receptor
    • More...
    • Androgen Receptor
    • Constitutive Androstane Receptor
    • Estrogen Receptor/ERR
    • Glucocorticoid Receptor
    • LXR
    • Mineralocorticoid Receptor
    • Nuclear Hormone Receptor 4A/NR4A
    • Orphan Nuclear Receptor
    • PPAR
    • Pregnane X Receptor (PXR)
    • Progesterone Receptor
    • RAR/RXR
    • REV-ERB
    • ROR
    • Thyroid Hormone Receptor
    • VD/VDR
    • VKOR
    • More...
    • Amino Acid Derivatives
    • Biochemical Assay Reagents
    • Drug Derivative
    • Drug Intermediate
    • Drug Isomer
    • Environmental Pollutants
    • Fluorescent Dye
    • Insecticide
    • Isotope-Labeled Compounds
    • Metal Nanoparticles
    • MOFs
    • mRNA
    • Phosphoramidites
    • Phytohormone
    • Plant Growth Regulators
    • Reference Standards
    • Sex Pheromone
    • Others
    • More...
    Signaling Pathways
    • Anti-infection
    • Antibody-Drug Conjugate/ADC Related
    • Apoptosis
    • Autophagy
    • Cell Cycle/DNA Damage
    • Cytoskeleton
    • Epigenetics
    • GPCR/G Protein
    • Immunology/Inflammation
    • JAK/STAT Signaling
    • MAPK/ERK Pathway
    • Membrane Transporter/Ion Channel
    • Metabolic Enzyme/Protease
    • Neuronal Signaling
    • NF-κB
    • PI3K/Akt/mTOR
    • PROTAC
    • Protein Tyrosine Kinase/RTK
    • Stem Cell/Wnt
    • TGF-beta/Smad
    • Vitamin D Related/Nuclear Receptor
    • Others
    • Anti-infection
    • Antibody-Drug Conjugate/ADC Related
    • Apoptosis
    • Autophagy
    • Cell Cycle/DNA Damage
    • Cytoskeleton
    • Epigenetics
    • GPCR/G Protein
    • Immunology/Inflammation
    • JAK/STAT Signaling
    • MAPK/ERK Pathway
    • Membrane Transporter/Ion Channel
    • Metabolic Enzyme/Protease
    • Neuronal Signaling
    • NF-κB
    • PI3K/Akt/mTOR
    • PROTAC
    • Protein Tyrosine Kinase/RTK
    • Stem Cell/Wnt
    • TGF-beta/Smad
    • Vitamin D Related/Nuclear Receptor
    • Others
    • Cytokines and Growth Factors
    • Immune Checkpoint Proteins
    • CAR-T Related Proteins
    • CD Antigens
    • Fc Receptors
    • Receptor Proteins
    • Enzymes & Regulators
    • Kinases
    • Complement System
    • Ubiquitin Related Proteins
    • Viral Proteins
    • Biotinylated Proteins
    • Fluorescent-labeled Recombinant Proteins
    • GMP-grade Proteins
    • Animal-free Recombinant Proteins
    • Isotope-Labeled Recombinant Proteins
    • Others
    • Interleukin & Receptors
    • Interferon & Receptors
    • Chemokine & Receptors
    • TNF Superfamily
    • CSF & Receptors
    • TGF-beta Superfamily
    • PDGFs & PDGFRs
    • VEGF & VEGFR
    • EGF Superfamily
    • FGF Family
    • HGF & Receptors
    • Neurotrophic Factors
    • Ephrin/Eph Family
    • Angiopoietins
    • IGF family
    • Peptide Hormone & Neuropeptides
    • Inhibitory Checkpoint Molecules
    • Stimulatory Immune Checkpoint Molecules
    • Butyrophilins
    • CD4
    • CD19
    • CD27 Ligand/CD70
    • CD138/Syndecan-1
    • Epithelial Cell Adhesion Molecule (EpCAM)
    • GPC-3
    • ErbB2/HER2
    • ErbB3/HER3
    • c-Met/HGFR
    • CA-125
    • ROR1
    • TROP-2
    • Folate Receptor alpha (FR-alpha)
    • CD314/NKG2D
    • CD319/SLAMF7
    • Siglec-3/CD33
    • CD7
    • MUC-1/CD227
    • T Cell CD Proteins
    • B Cell CD Proteins
    • NK Cell CD Proteins
    • Macrophage CD Proteins
    • Monocyte CD Proteins
    • Stem Cell CD Proteins
    • Platelet CD Proteins
    • Erythrocyte CD Proteins
    • Dendritic Cell CD Proteins
    • Epithelial cell CD Proteins
    • Endothelial cell CD Proteins
    • Signal Transduction-related CD Proteins
    • Cell Adhesion-related CD Proteins
    • Fc-gamma Receptor
    • FcRn
    • Fc-epsilon Receptor
    • Fc alpha/mu Receptor
    • Fc Receptor-like Proteins
    • Immunoglobulin Fc Region
    • Fc alpha RI/CD89
    • Receptor Tyrosine Kinases
    • Receptor Serine/Threonine Kinases
    • Receptor Tyrosine Phosphatase
    • Receptor Guanylyl Cyclase Family
    • Cell Adhesion Molecules (CAMs)
    • G-Protein-Coupled Receptors (GPCRs)
    • Nuclear Receptor Superfamily
    • Pattern Recognition Receptors
    • Notch family
    • Siglec
    • Leukocyte Immunoglobin-like Receptors
    • Killer-Cell Immunoglobulin-like Receptors
    • Cytokine Receptors
    • Oxidoreductases (EC 1)
    • Transferases (EC 2)
    • Hydrolases (EC 3)
    • Lyases (EC 4)
    • Isomerases (EC 5)
    • Ligases (EC 6)
    • Translocases (EC 7)
    • Matrix Metalloproteinases
    • ADAMs/ADAMTSs
    • Cathepsin
    • Carboxypeptidase
    • Angiotensin-converting Enzymes
    • Caspase
    • Carbonic Anhydrase
    • Serine/Threonine Kinase Proteins
    • Protein Tyrosine Kinases
    • Phosphatase
    • Topoisomerase
    • Protease Inhibitors
    • Protein Kinase Inhibitor Peptide (PKI)
    • Cyclin-Dependent Kinase Inhibitor Proteins
    • Cystatin Family
    • AGC
    • Atypical Kinases
    • CAMK
    • CK1
    • CMGC
    • Lipid Kinase
    • Pseudokinases
    • STE
    • TK
    • TKL
    • Other Kinases
    • Complement Component 1
    • Complement Component 2
    • Complement Component 3
    • Complement Component 4
    • Complement Component 5
    • Complement Component 6
    • Complement Component 7
    • Complement Component 8
    • Mannose-binding Protein
    • MASP-1
    • MASP-2
    • Complement Regulatory Proteins
    • Complement Receptor
    • Complement Component 9
    • Ubiquitin/UBLs
    • Ubiquitin Enzymes
    • Deubiquitinase
    • SARS-CoV-2 Proteins
    • Zika Virus Proteins
    • RSV Proteins
    • Hepatitis C Virus Proteins
    • HIV Proteins
    • HPV Proteins
    • Influenza Viruses Proteins
    • Dengue Virus Proteins
    • Ebola Virus Proteins
    • Bacterial/Fungal Proteins
    • CHIKV
    • IL-1R
    • IL-2 Receptor
    • IL-4
    • IL-4 Receptor
    • IL-5 Receptor
    • IL-6R
    • IL-7 Receptor
    • IL-10 Receptor
    • IL-11 Receptor
    • IL-12
    • IL-12 Receptor
    • IL-15 Receptor
    • IL-17
    • IL-25/IL-17E
    • IL-17 Receptor
    • IL-18 Receptor
    • IL-20 Receptor
    • IL-21R
    • IL-22 Receptor
    • IL-27
    • IL-36
    • IL-39
    • IL-35 Receptor
    • IL-28 Receptor
    • IL-1
    • IL-1RA
    • IL-2
    • IL-5
    • IL-6
    • IL-7
    • IL-9
    • IL-9R
    • IL-10
    • IL-11
    • IL-13
    • IL-13 Receptor
    • IL-15
    • IL-16
    • IL-18
    • IL-18BP
    • IL-19
    • IL-20
    • IL-21
    • IL-22
    • IL-22BP
    • IL-23
    • IL-23 Receptor
    • IL-24
    • IL-26
    • IL-27 Receptor
    • IL-31
    • IL-31 Receptor
    • IL-32
    • IL-33
    • IL-34
    • IL-35
    • IL-36RA
    • IL-1 Rrp2
    • IL-37
    • IL-38
    • OSM Receptor
    • More...
    • IFN-alpha
    • IFN-beta
    • IFN-ε
    • IFN-τ
    • IFN-ω
    • IFN-ζ
    • IFN-γ
    • IFN-α/β Receptor
    • IFN-gamma Receptor
    • IFN-lambda
    • More...
    • CC Chemokines
    • CC Chemokine Receptor
    • CXC Chemokines
    • CXC Chemokine Receptor
    • C Chemokines
    • CX3CL1
    • More...
    • TNF Superfamily Ligands
    • TNF Receptor Superfamily
    • More...
    • M-CSF
    • G-CSF
    • GM-CSF
    • Multi-CSF/IL-3
    • M-CSF R
    • G-CSF R
    • GM-CSFR
    • IL-3R alpha/CD123
    • CD131
    • More...
    • TGF-beta Receptor
    • Bone Morphogenetic Proteins (BMPs)
    • BMP Receptor
    • Activin/Inhibins
    • Activin/Inhibins Receptor
    • Smad Family
    • Growth Differentiation Factor
    • GDNF family
    • TGF-β
    • More...
    • PDGF
    • PDGFR
    • More...
    • VEGF
    • VEGFR
    • More...
    • EGF
    • TGF-alpha
    • Amphiregulin
    • Epiregulin
    • Betacellulin
    • Neuregulins
    • Epigen
    • EGFR/ErbB family
    • More...
    • Fibroblast Growth Factor
    • FGFR
    • More...
    • HGF
    • c-Met/HGFR
    • More...
    • Glycoprotein 130 (gp130)
    • TNF-alpha
    • Neurotrophins/NGF
    • GDNF family
    • CDNF/MANF family
    • IL-1
    • Leukemia Inhibitory Factor
    • CNTF
    • TGF-β
    • Cardiotrophin-1
    • Neuropoietin
    • Ciliary Neurotrophic Factor Receptor (CNTFR)
    • IL-6
    • More...
    • Ephrins
    • Eph Receptors
    • More...
    • ANG-1
    • ANG-2
    • Angiopoietin-4
    • Angiopoietin Like 1
    • Angiopoietin Like 2
    • Angiopoietin Like 3 Proteins
    • Angiopoietin Like 4
    • Angiopoietin Like 5
    • Angiopoietin-Like 7
    • Angiopoietin-Like 8
    • TIE-1
    • TIE-2
    • More...
    • Insulin-like Growth Factor I (IGF-1)
    • Insulin-like Growth Factor 2 (IGF-II)
    • IGFBP-1
    • IGFBP-2
    • IGFBP-3
    • IGFBP-4
    • IGFBP-5
    • IGFBP-6
    • IGFBP-7
    • CTGF
    • More...
    • FSH
    • CG-alpha
    • Chorionic Gonadotropin beta Chain (CG-beta)
    • Choriogonadotropin Subunit beta 7 (CGB7)
    • Insulin
    • Leptin
    • Prolactin
    • Adiponectin
    • Adrenomedullin
    • Glycoprotein Hormone alpha-2 (GPHA2)
    • Galanin
    • Gastric Inhibitory Peptide (GIP)
    • GLP-1
    • Natriuretic Peptides B (NPPB)
    • Calcitonin
    • Growth Hormone/Somatotropin
    • Gastrin
    • More...
    • HVEM
    • FGL-1
    • CTLA-4
    • PD-1
    • PD-L1
    • TIM-3
    • Galectin-9
    • TIGIT Protein
    • VISTA
    • B7-H3
    • B7-H4
    • BTLA
    • PVRIG
    • IDO
    • FGL-2
    • LAG-3/CD223
    • CD300a
    • NTB-A/CD352
    • B7-DC/PD-L2/CD273
    • LAIR-1/CD305
    • More...
    • 4-1BBL
    • OX40 Ligand
    • 4-1BB
    • HVEM
    • OX40/CD134
    • B7-H2/ICOSLG
    • B7-H6
    • CD27 Ligand/CD70
    • ICOS/CD278
    • CD40 Ligand/CD154
    • GITR/CD357
    • LIGHT/CD258
    • DNAM-1/CD226
    • CD200R
    • More...
    • BTN1A1
    • BTN2A1
    • BTN2A2
    • BTN3A2
    • BTN3A3
    • BTNL2
    • BTNL4
    • BTNL6
    • BTNL9
    • Butyrophilin Like 8 (BTNL8)
    • BTN3A1/CD277
    • More...
    • OX40 Ligand
    • 4-1BB
    • CTLA-4
    • PD-1
    • OX40/CD134
    • CD4
    • CD3ζ
    • IL-2R alpha/CD25
    • L-Selectin/CD62L
    • Fas/CD95
    • IL-6RA/CD126
    • TLR2/CD282
    • TLR3/CD283
    • TLR4/CD284
    • ICOS/CD278
    • CD30L/CD153
    • FasL/CD178
    • CD314/NKG2D
    • CD40 Ligand/CD154
    • RANKL/CD254
    • B7-H2/CD275
    • CD218a/IL-18R alpha
    • CD1b
    • CD1e
    • CD1a
    • CD1c
    • CD1d
    • CD3D-CD3E Heterodimer Proteins
    • CD3E-CD3G Heterodimer Proteins
    • CD3d
    • CD3g
    • CD3e
    • CD5
    • CD8a
    • CD8b
    • FcγRIIIA/CD16a
    • FcγRIIIB/CD16b
    • DPP IV/CD26
    • CD27
    • CD28
    • CD30
    • CD38
    • CD39
    • CD40
    • CD45
    • CD73
    • B7-1/CD80
    • CD83
    • B7-2/CD86
    • CD150
    • CD161/KLRB1
    • CCR2/CD192
    • Tetraspanin 7/CD231
    • More...
    • CD127/IL-7RA
    • IL-21R
    • HVEM
    • CD19
    • CD138/Syndecan-1
    • IL-2R alpha/CD25
    • Fas/CD95
    • TLR4/CD284
    • CD29/Integrin beta-1
    • CD21/CR2
    • CD24/Heat-stable Antigen
    • CD1d
    • CD5
    • CD10/Neprilysin
    • CD20
    • Siglec-2/CD22
    • Fc epsilon RII/CD23
    • CD27
    • CD28
    • CD34
    • CD37/Tspan-26
    • CD38
    • CD40
    • CD44/ECMR-III
    • CD45
    • CD69
    • CD72
    • CD74
    • Ig-alpha/CD79a
    • Ig-β/CD79b
    • B7-1/CD80
    • CD83
    • CD84
    • B7-2/CD86
    • CD93
    • CD117/c-KIT
    • CD147
    • DEP-1/CD148
    • CD257/BAFF
    • BCMA/CD269
    • CD307a/FCRL1
    • More...
    • IL-2R gamma/Common gamma-Chain/CD132
    • CD127/IL-7RA
    • IL-21R
    • CD27 Ligand/CD70
    • IL-2R alpha/CD25
    • Fas/CD95
    • FasL/CD178
    • LIR-9/CD85f
    • IL-2R beta/CD122
    • CD158z/KIR3DL3
    • NKG2A/CD159a
    • IL-12R beta 1/CD212
    • IL-15R alpha/CD215
    • TRAIL/CD253
    • CD314/NKG2D
    • ICAM-1/CD54
    • CD85a/ILT-5
    • CD85e/LILRA3
    • CD85i/LIR-6
    • CD85j/LIR-1
    • LAG-3/CD223
    • 2B4/CD244
    • DNAM-1/CD226
    • CD218a/IL-18R alpha
    • CD218b/IL-18RAP
    • Siglec-3/CD33
    • CD3d
    • CD3g
    • CD3e
    • CD7
    • FcγRIIIA/CD16a
    • FcγRIIIB/CD16b
    • CD27
    • CD28
    • CD34
    • CD43
    • CD44/ECMR-III
    • CD48
    • NCAM-1/CD56
    • LFA-3/CD58
    • CD59
    • CD69
    • B7-2/CD86
    • CD94
    • CD96
    • CD99/MIC2
    • CD100/Semaphorin-4D
    • ICAM-2/CD102
    • LAMP-1/CD107a
    • LAMP-2/CD107b
    • Nectin-1/CD111
    • Nectin-2/CD112
    • CD117/c-KIT
    • PVR/CD155
    • CD158a/KIR2DL1
    • CD158d/KIR2DL4
    • NKG2C/CD159c
    • CD160
    • CD161/KLRB1
    • CD336/NCR2
    • CD337/NCR3
    • CRTAM/CD355
    • More...
    • OX40 Ligand
    • 4-1BB
    • HVEM
    • G-CSF R
    • CTLA-4
    • PD-1
    • PD-L1
    • OX40/CD134
    • CD27 Ligand/CD70
    • L-Selectin/CD62L
    • IL-6RA/CD126
    • CD30L/CD153
    • LAIR-2/CD306
    • CD29/Integrin beta-1
    • ICAM-1/CD54
    • CD85a/ILT-5
    • CD85e/LILRA3
    • CD85i/LIR-6
    • CD85j/LIR-1
    • CD40 Ligand/CD154
    • DC-SIGN1/CD209
    • LAG-3/CD223
    • 2B4/CD244
    • RANKL/CD254
    • RANK/CD265
    • CD300a
    • NTB-A/CD352
    • GITR/CD357
    • LIGHT/CD258
    • B7-DC/PD-L2/CD273
    • CD36/SR-B2
    • CD11c
    • SIRP beta 1/CD172b
    • CLM-7/CD300b
    • CD300c
    • CD300e
    • IREM-1/CD300f
    • CD319/SLAMF7
    • CD353/SLAMF8
    • TREM-1/CD354
    • B7-H2/CD275
    • B7-H3/CD276
    • LAIR-1/CD305
    • GM-CSF R alpha/CD116
    • IL-4R alpha/CD124
    • Siglec-3/CD33
    • CD2
    • CD3e
    • CD7
    • CD8a
    • CD8b
    • Aminopeptidase N/CD13
    • CD14
    • FcγRIIIA/CD16a
    • FcγRIIIB/CD16b
    • CD20
    • DPP IV/CD26
    • CD27
    • CD28
    • CD30
    • CD31/PECAM-1
    • Fc gamma RII/CD32
    • CD34
    • CD40
    • CD43
    • CD44/ECMR-III
    • CD45
    • CD48
    • CD51/Integrin alpha V
    • CD53
    • LFA-3/CD58
    • Fc-gamma Receptor I/CD64
    • CD68
    • CD73
    • B7-1/CD80
    • B7-2/CD86
    • Fc alpha RI/CD89
    • Thy-1/CD90
    • LRP-1/CD91
    • CD93
    • CD96
    • CD97
    • ICAM-2/CD102
    • CD105
    • Nectin-2/CD112
    • Nectin-3/CD113
    • CD131
    • BDCA-3/CD141
    • Tissue Factor/CD142
    • CD147
    • DEP-1/CD148
    • CD150
    • PVR/CD155
    • CD160
    • PSGL-1/CD162
    • CD163
    • ALCAM/CD166
    • CD171/L1CAM
    • CCR2/CD192
    • CD200
    • LY9/CD229
    • CD257/BAFF
    • BAFF R/CD268
    • BTLA/CD272
    • More...
    • PD-L1
    • TLR2/CD282
    • TLR3/CD283
    • TLR4/CD284
    • CD85a/ILT-5
    • CD85e/LILRA3
    • CD85j/LIR-1
    • DC-SIGN1/CD209
    • CD300a
    • NTB-A/CD352
    • GITR/CD357
    • IL-1R2/CD121b
    • LIGHT/CD258
    • B7-DC/PD-L2/CD273
    • CD11c
    • CLM-7/CD300b
    • CD300c
    • CD300e
    • IREM-1/CD300f
    • CD319/SLAMF7
    • CD353/SLAMF8
    • TREM-1/CD354
    • B7-H3/CD276
    • LAIR-1/CD305
    • GM-CSF R alpha/CD116
    • FCGR2A/CD32a
    • FcγRIIB/CD32b
    • CD43
    • CD45
    • Fc-gamma Receptor I/CD64
    • CD68
    • CD74
    • B7-1/CD80
    • CD84
    • B7-2/CD86
    • LRP-1/CD91
    • CD97
    • ICAM-2/CD102
    • CD105
    • LAMP-2/CD107b
    • CD131
    • CD147
    • CD150
    • PVR/CD155
    • CD163
    • CD200
    • CD301/CLEC10A
    • CD302/CLEC13A
    • More...
    • CD127/IL-7RA
    • 4-1BB
    • Nerve Growth Factor Receptor (NGFR/CD271)
    • CD19
    • CD138/Syndecan-1
    • ErbB2/HER2
    • L-Selectin/CD62L
    • IL-6RA/CD126
    • CD29/Integrin beta-1
    • ICAM-1/CD54
    • 2B4/CD244
    • CD36/SR-B2
    • CEACAM8/NCA-95/CD66b
    • ACE/CD143
    • CD49e/Integrin alpha-5
    • MCAM/CD146
    • CD24/Heat-stable Antigen
    • CD66c/CEACAM6
    • CD66d/CEACAM3
    • CD66e/CEACAM5
    • Siglec-3/CD33
    • FGFR-1
    • FGFR-2
    • FGFR-3
    • FcγRIIIB/CD16b
    • CD20
    • Siglec-2/CD22
    • DPP IV/CD26
    • CD27
    • CD31/PECAM-1
    • CD34
    • CD38
    • CD44/ECMR-III
    • CD45
    • Integrin Associated Protein/CD47
    • CD48
    • CD51/Integrin alpha V
    • NCAM-1/CD56
    • CD59
    • PSBG1 Protein/CD66f
    • CD68
    • CD69
    • CD73
    • Thy-1/CD90
    • CD93
    • CD96
    • CD105
    • VCAM-1/CD106
    • LAMP-1/CD107a
    • TPO-R/CD110
    • Nectin-2/CD112
    • CD117/c-KIT
    • IL-3R alpha/CD123
    • CD133
    • Flt-3/CD135
    • CD150
    • CD163
    • MUC-24/CD164
    • ALCAM/CD166
    • CD171/L1CAM
    • CCR2/CD192
    • CD200
    • Glycophorin-A/CD235a
    • CD318/CDCP1
    • CD324/E-Cadherin
    • CD326/EpCAM
    • More...
    • G-CSF R
    • PDGF-R-alpha
    • PDGF-R-beta
    • CD29/Integrin beta-1
    • ICAM-1/CD54
    • CD36/SR-B2
    • CD98/SLC3A2
    • DNAM-1/CD226
    • CD49e/Integrin alpha-5
    • DAF Protein/CD55
    • P-Selectin/CD62P
    • FCGR2A/CD32a
    • FcγRIIB/CD32b
    • DRAP-27/CD9
    • Fc epsilon RII/CD23
    • CD31/PECAM-1
    • Fc gamma RII/CD32
    • CD34
    • GP-IX/CD42a
    • GP-Ib alpha/CD42b
    • CD42c/GP-Ib beta
    • CD43
    • Membrane Cofactor Protein/CD46
    • Integrin Associated Protein/CD47
    • CD48
    • CD51/Integrin alpha V
    • LAMP3/CD63
    • CD69
    • CD82
    • CD93
    • CD99/MIC2
    • ICAM-2/CD102
    • LAMP-1/CD107a
    • LAMP-2/CD107b
    • TPO-R/CD110
    • Nectin-1/CD111
    • Nectin-2/CD112
    • CD147
    • DEP-1/CD148
    • CD150
    • CD324/E-Cadherin
    • More...
    • CD36/SR-B2
    • CD49e/Integrin alpha-5
    • DAF Protein/CD55
    • DC-SIGN2/CLEC4M/CD299
    • CD30
    • CD31/PECAM-1
    • CD44/ECMR-III
    • Integrin Associated Protein/CD47
    • LFA-3/CD58
    • CD59
    • CD99/MIC2
    • ICAM-2/CD102
    • LAMP-1/CD107a
    • LAMP-2/CD107b
    • CD108/Semaphorin-7A
    • Nectin-1/CD111
    • CD147
    • Glycophorin-A/CD235a
    • CD236/Glycophorin C
    • CD238
    • CD239/BCAM
    • CD297/ART4
    • CD324/E-Cadherin
    • More...
    • 4-1BBL
    • 4-1BB
    • CTLA-4
    • CD4
    • CD19
    • TLR3/CD283
    • TLR4/CD284
    • ICAM-1/CD54
    • CD85a/ILT-5
    • CD85e/LILRA3
    • CD85j/LIR-1
    • DC-SIGN1/CD209
    • CD300a
    • B7-DC/PD-L2/CD273
    • CD36/SR-B2
    • CD49e/Integrin alpha-5
    • CD11c
    • ILT-7/CD85g
    • MCAM/CD146
    • Siglec-5/CD170
    • SIRP alpha/CD172a
    • SIRP beta 1/CD172b
    • DC-SIGN2/CLEC4M/CD299
    • CLM-7/CD300b
    • CD300c
    • CD300e
    • IREM-1/CD300f
    • CD319/SLAMF7
    • CD353/SLAMF8
    • TREM-1/CD354
    • B7-H2/CD275
    • B7-H3/CD276
    • LAIR-1/CD305
    • ICAM-3/CD50
    • FCGR2A/CD32a
    • FcγRIIB/CD32b
    • Siglec-3/CD33
    • CD1a
    • CD1c
    • CD1d
    • CD2
    • CD3e
    • CD5
    • CD5L
    • CD6
    • CD8a
    • CD8b
    • CD14
    • FcγRIIIA/CD16a
    • FcγRIIIB/CD16b
    • CD20
    • Siglec-2/CD22
    • CD28
    • Fc gamma RII/CD32
    • CD40
    • CD43
    • CD44/ECMR-III
    • CD45
    • Integrin Associated Protein/CD47
    • NCAM-1/CD56
    • LFA-3/CD58
    • Fc-gamma Receptor I/CD64
    • CD68
    • CD74
    • B7-1/CD80
    • CD83
    • B7-2/CD86
    • LRP-1/CD91
    • CD93
    • CD97
    • CD99/MIC2
    • ICAM-2/CD102
    • IL-3R alpha/CD123
    • Flt-3/CD135
    • BDCA-3/CD141
    • CD147
    • CD150
    • CD163
    • CD171/L1CAM
    • CCR2/CD192
    • CD200
    • MSR1/CD204
    • DEC-205/CD205
    • Langerin/CD207
    • BDCA-4/CD304
    • BST-2/CD317
    • 8D6A/CD320
    • CD326/EpCAM
    • More...
    • Glycoprotein 130 (gp130)
    • 4-1BBL
    • HVEM
    • PD-L1
    • CD138/Syndecan-1
    • ErbB2/HER2
    • IL-6RA/CD126
    • TLR2/CD282
    • TLR3/CD283
    • TLR4/CD284
    • FasL/CD178
    • CD29/Integrin beta-1
    • ICAM-1/CD54
    • ACE/CD143
    • CD98/SLC3A2
    • CD49e/Integrin alpha-5
    • DAF Protein/CD55
    • CD21/CR2
    • CD24/Heat-stable Antigen
    • CD66c/CEACAM6
    • CD66d/CEACAM3
    • CD66e/CEACAM5
    • DDR1/CD167a
    • IL-17RA/CD217
    • B7-H2/CD275
    • B7-H3/CD276
    • LAIR-1/CD305
    • Frizzled-10/CD350
    • IGF-II R/CD222
    • TNF-RI/CD120a
    • TNF-R2/CD120b
    • IL-1R1/CD121a
    • IL-4R alpha/CD124
    • IGF-I R/CD221
    • TWEAK R/CD266
    • JAM-B/CD322
    • Frizzled-4/CD344
    • FGFR-1
    • FGFR-2
    • FGFR-3
    • FGFR-4
    • CD1d
    • DRAP-27/CD9
    • Aminopeptidase N/CD13
    • Fc epsilon RII/CD23
    • DPP IV/CD26
    • CD34
    • CD39
    • CD40
    • CD44/ECMR-III
    • Membrane Cofactor Protein/CD46
    • Integrin Associated Protein/CD47
    • CD52
    • CD53
    • LFA-3/CD58
    • PSBG1 Protein/CD66f
    • CD68
    • CD69
    • CD73
    • CD74
    • TAPA-1/CD81
    • CD82
    • LRP-1/CD91
    • CD99/MIC2
    • Nectin-1/CD111
    • Nectin-2/CD112
    • Nectin-3/CD113
    • LIF-R/CD118
    • Tissue Factor/CD142
    • DEP-1/CD148
    • MUC-24/CD164
    • ALCAM/CD166
    • CD171/L1CAM
    • INSR/CD220
    • MUC-1/CD227
    • CD228
    • PRNP/CD230
    • CD239/BCAM
    • Glutamyl Aminopeptidase/CD249
    • ALK-3/CD292
    • CD318/CDCP1
    • JAM-A/CD321
    • CD324/E-Cadherin
    • CD326/EpCAM
    • Jagged-1/CD339
    • Syndecan-2/CD362
    • More...
    • Glycoprotein 130 (gp130)
    • G-CSF R
    • CD138/Syndecan-1
    • ErbB2/HER2
    • FasL/CD178
    • CD29/Integrin beta-1
    • ICAM-1/CD54
    • DC-SIGN1/CD209
    • CD36/SR-B2
    • CD98/SLC3A2
    • CD49e/Integrin alpha-5
    • DAF Protein/CD55
    • IL-17RA/CD217
    • IGF-II R/CD222
    • ICAM-3/CD50
    • E-Selectin/CD62E
    • P-Selectin/CD62P
    • GM-CSF R alpha/CD116
    • TNF-RI/CD120a
    • TNF-R2/CD120b
    • IL-1R1/CD121a
    • IL-4R alpha/CD124
    • CD218a/IL-18R alpha
    • CD218b/IL-18RAP
    • IGF-I R/CD221
    • TWEAK R/CD266
    • JAM-B/CD322
    • Frizzled-4/CD344
    • FcγRIIB/CD32b
    • TIE-2
    • FGFR-1
    • CD140b/PDGF-R-beta
    • DRAP-27/CD9
    • CD10/Neprilysin
    • Aminopeptidase N/CD13
    • CD31/PECAM-1
    • CD34
    • CD39
    • CD40
    • CD44/ECMR-III
    • Membrane Cofactor Protein/CD46
    • Integrin Associated Protein/CD47
    • CD51/Integrin alpha V
    • LFA-3/CD58
    • LAMP3/CD63
    • TFR-1/CD71
    • CD73
    • CD74
    • TAPA-1/CD81
    • CD82
    • B7-2/CD86
    • U-PAR/CD87
    • Thy-1/CD90
    • CD93
    • CD99/MIC2
    • ICAM-2/CD102
    • CD105
    • VCAM-1/CD106
    • LAMP-1/CD107a
    • LAMP-2/CD107b
    • Nectin-1/CD111
    • Nectin-2/CD112
    • IL-3R alpha/CD123
    • CD131
    • BDCA-3/CD141
    • BST1/CD157
    • CD160
    • CD177
    • CD201/Activated Protein C Receptor
    • INSR/CD220
    • IFITM1/CD225
    • CD239/BCAM
    • Glutamyl Aminopeptidase/CD249
    • CD297/ART4
    • BDCA-4/CD304
    • JAM-A/CD321
    • Jagged-1/CD339
    • Syndecan-2/CD362
    • More...
    • Fc gamma RIII/CD16
    • Fc gamma RIV/CD16-2
    • Fc gamma RII/CD32
    • Fc-gamma Receptor I/CD64
    • More...
    • Fc epsilon RIA
    • Fc epsilon RII/CD23
    • More...
    • Fc Receptor Like 1 (FCRL1)
    • Fc Receptor Like 2 (FCRL2)
    • Fc Receptor-like 5 (FCRL5)
    • Fc Receptor-like 6 (FCRL6)
    • More...
    • IgG
    • IgG1
    • IgG2
    • IgG2A
    • IgG2B
    • IgG2C
    • IgG3
    • IgG4
    • IgE
    • IgM
    • IgA
    • More...
    • c-Met/HGFR
    • EGFR/ErbB family
    • FGFR
    • Eph Receptors
    • DDR Family
    • Trk Receptors
    • ROR family
    • VEGFR
    • PDGFR
    • Insulin Receptor (INSR)
    • Muscle-Specific Kinase (MuSK)
    • TAM Receptor
    • TIE Receptors
    • CD117/c-KIT
    • More...
    • ALK-3
    • ALK-6
    • ALK-2/ACVR1
    • ALK-4/Activin RIB
    • ALK-7
    • Activin A Receptor Type 2A (ACTR-IIA)
    • Activin A Receptor Type 2B (ACVR2B)
    • ALK-1/ACVRL1
    • Anti-Muellerian Hormone Type-2 Receptor (AMHR2)
    • TGF-β Receptor 1
    • TGF-beta Receptor 2
    • Type III TGF-β Receptor
    • TGF-β Receptor 1
    • More...
    • IA-2/PTPRN
    • More...
    • Natriuretic Peptide Receptor B (NPR2)
    • More...
    • Cadherins
    • Selectin
    • Integrin
    • Immunoglobulin-like Cell Adhesion Molecules
    • More...
    • Muscarinic Acetylcholine Receptor
    • Endothelin Receptor
    • FSH Receptor
    • GPR37
    • Protease-activated Receptor
    • TSH Receptor
    • Chemokine Receptor
    • Adhesion GPCRs
    • CT Receptor (Calcitonin Receptor)
    • Glucagon Receptor
    • Metabotropic Glutamate Receptors
    • Frizzled
    • Adenosine Receptor
    • Cannabinoid Receptor
    • GPR49
    • Somatostatin Receptor
    • More...
    • Peroxisome Proliferator-activated Receptor
    • Estrogen Receptor
    • Androgen Receptor
    • Progesterone Receptor
    • More...
    • Toll-like Receptor
    • NOD-like Receptor
    • RIG-I-like Receptor
    • C-type Lectin Receptors
    • AIM2-like receptors
    • More...
    • Notch-1
    • Notch-2
    • Notch-3
    • Notch-4
    • Delta-like 1 (DLL1 )
    • Delta-like 3 (DLL3)
    • Delta-like 4 (DLL4)
    • Jagged-1/CD339
    • More...
    • Siglec-5/CD170
    • Siglec-1
    • Siglec-3/CD33
    • Myelin Associated Glycoprotein (MAG/Siglec-4a)
    • Siglec-8
    • Siglec-9
    • Siglec-10
    • Siglec-11
    • Siglec-15
    • Siglec-E
    • Siglec-2/CD22
    • More...
    • LIR-9/CD85f
    • CD85a/ILT-5
    • CD85e/LILRA3
    • CD85i/LIR-6
    • CD85j/LIR-1
    • ILT-7/CD85g
    • LILRA2
    • LILRA6
    • ILT-4
    • Leukocyte Ig-Like Receptor B4
    • Leukocyte Immunoglobulin Like Receptor B5/LIR-8
    • More...
    • KIR2DL5
    • KIR2DS1
    • KIR2DS3
    • CD158a/KIR2DL1
    • CD158b1/KIR2DL2
    • CD158b2/KIR2DL3
    • CD158d/KIR2DL4
    • More...
    • MMP-1
    • MMP-2
    • MMP-3
    • MMP-7
    • MMP-10
    • MMP-12
    • MMP-8
    • MMP-9
    • MMP-13
    • MMP-14
    • MMP-16
    • MMP-19
    • MMP-26
    • More...
    • ADAM8
    • ADAM9
    • ADAM10
    • ADAM12
    • ADAM15
    • ADAM17/TACE
    • ADAMDEC1
    • ADAMTSL-1/Punctin-1
    • More...
    • Cathepsin A
    • Cathepsin B
    • Cathepsin C
    • Cathepsin D
    • Cathepsin E
    • Cathepsin F
    • Cathepsin H
    • Cathepsin K
    • Cathepsin L1
    • Cathepsin V/Cathepsin L2
    • Cathepsin S
    • Cathepsin W
    • Cathepsin X/Cathepsin Z
    • More...
    • Cathepsin A
    • Carboxypeptidase A
    • Carboxypeptidase B
    • Carboxypeptidase E
    • Carboxypeptidase M
    • Carboxypeptidase Q
    • CPVL
    • Serine Carboxypeptidase 1
    • More...
    • ACE/CD143
    • Angiotensin-Converting Enzyme 2 (ACE2)
    • More...
    • Caspase-1
    • Caspase-3
    • Caspase 7
    • Caspase-8
    • Caspase-10
    • Caspase 14
    • More...
    • Carbonic Anhydrase 1 (CA1)
    • Carbonic Anhydrase 2 (CA-II)
    • Carbonic Anhydrase 3 (CA-III)
    • Carbonic Anhydrase 4 (CA IV)
    • Carbonic Anhydrase 5B (CA-VB)
    • Carbonic Anhydrase 7 (CA-VII)
    • Carbonic Anhydrase 8 ( CA-VIII)
    • Carbonic Anhydrase 9 (CA IX)
    • Carbonic Anhydrase 10
    • Carbonic Anhydrase 11
    • Carbonic Anhydrase 12 (CA-XII)
    • Carbonic Anhydrase 13 (CA-XIII)
    • Carbonic Anhydrase 14 (CA-XIV)
    • More...
    • ALK-3
    • ALK-6
    • ALK-2/ACVR1
    • ALK-4/Activin RIB
    • ALK-7
    • Activin A Receptor Type 2A (ACTR-IIA)
    • Activin A Receptor Type 2B (ACVR2B)
    • ALK-1/ACVRL1
    • TGF-β Receptor 1
    • TGF-beta Receptor 2
    • Type III TGF-β Receptor
    • G protein-coupled receptor kinases (GRKs)
    • Glycogen Synthase Kinase-3 (GSK-3)
    • Serine/Threonine Kinase 4
    • Serine/Threonine Kinase 10
    • Serine/Threonine-Protein Kinase 11
    • Serine/Threonine Kinase 16
    • Serine/Threonine-Protein Kinase 26
    • Serine/Threonine Kinase 40
    • Polo-like Kinase (PLK)
    • Checkpoint Kinase 1 (Chk1)
    • Checkpoint Kinase 2 (Chk2)
    • Cytokine-independent Survival Kinase (SGK3)
    • Doublecortin Like Kinase 1
    • NIMA Related Kinase 3
    • NEK7
    • Endoplasmic Reticulum To Nucleus Signaling 1 (ERN1/IRE1)
    • VRK Serine/Threonine Kinase 1
    • RIO Kinase 1
    • PKC-nu
    • p21-Activated Kinase 1
    • p21-Activated Kinase 3
    • SRSF Protein Kinase 1
    • SRSF Protein Kinase 3
    • TLK1
    • TLK2
    • TAO Kinase 3
    • Oxidative Stress Responsive Kinase 1 (OXSR1)
    • AKT Serine/Threonine Kinase 1 (AKT1)
    • AKT Serine/Threonine Kinase 2 (AKT2)
    • AKT Serine/Threonine Kinase 3 (AKT3)
    • Raf-1
    • Receptor-interacting Serine/Threonine-protein Kinase 3 (RIPK3)
    • AMPK
    • Cyclin-Dependent Kinases (CDKs)
    • MAPK Family
    • Receptor-interacting Serine/Threonine-protein Kinase 2 (RIPK2)
    • CDC-like kinase 3 (CLK3)
    • Checkpoint Kinase 1 (Chk1)
    • Checkpoint Kinase 2 (Chk2)
    • Endoplasmic Reticulum To Nucleus Signaling 1 (ERN1/IRE1)
    • Receptor-interacting Serine/Threonine-protein Kinase 3 (RIPK3)
    • TGF-β Receptor 1
    • More...
    • c-Met/HGFR
    • EGFR/ErbB family
    • FGFR
    • Eph Receptors
    • DDR Family
    • Trk Receptors
    • ROR family
    • VEGFR
    • PDGFR
    • Muscle-Specific Kinase (MuSK)
    • Brutons Tyrosine Kinase (BTK)
    • CDC-like kinase 3 (CLK3)
    • Death-Associated Protein Kinase 1 (DAPK1)
    • Tyrosine-protein Kinase YES
    • Tyrosine-Protein Kinase CSK
    • TrkA
    • TrkB
    • TrkC
    • TAM Receptor
    • Death-Associated Protein Kinase 3 (DAPK3)
    • TIE Receptors
    • Flt-3
    • Janus Kinase 1 (JAK1)
    • JAK2
    • Lymphocyte-Specific Protein Tyrosine Kinase
    • ABL1
    • IL-2 Inducible T-Cell Kinase (ITK/TSK)
    • FES Proto-Oncogene, Tyrosine Kinase
    • Activated Cdc42-Associated Kinase 1 (ACK1)
    • B Lymphoid Tyrosine Kinase
    • Breast Tumor Kinase
    • Janus Kinase 1 (JAK1)
    • IL-2 Inducible T-Cell Kinase (ITK/TSK)
    • More...
    • Protein tyrosine phosphatases
    • Acid Phosphatase
    • Alkaline Phosphatase
    • Serine/Threonine Phosphatase
    • More...
    • DNA topoisomerase II
    • More...
    • Serpin (Protease Inhibitor)
    • Inter-Alpha-Trypsin Inhibitors (ITI)
    • Tissue Inhibitor of Metalloproteinase (TIMPs)
    • Cystatin Family
    • More...
    • cAMP-Dependent Protein Kinase A Inhibitor beta
    • More...
    • Cyclin Dependent Kinase Inhibitor 2A (CDKN2A)
    • Cyclin Dependent Kinase 4 Inhibitor C (CDKN2C)
    • Cyclin-Dependent Kinase 4 Inhibitor D
    • Cyclin Dependent Kinase Inhibitor 1A (CDKN1A)
    • Cyclin-Dependent Kinase Inhibitor 1B (CDKN1B)
    • More...
    • Kininogen-1
    • Cystatin-1
    • Cystatin A
    • Cystatin-2
    • Cystatin B
    • Cystatin C
    • Cystatin S
    • Cystatin D
    • Cystatin F
    • Cystatin M
    • Histidine-Proline-rich Glycoprotein (HPRG)
    • More...
    • AKT
    • DMPK
    • GRK
    • NDR
    • PDK1
    • PKA
    • PKC
    • PKG
    • PKN
    • RSK
    • RSKL
    • SGK
    • YANK
    • More...
    • ABC1
    • Alpha
    • PDHK
    • PIKK
    • RIO
    • More...
    • CAMK1
    • CAMK2
    • CAMKL
    • CAMK-Unique
    • CASK
    • DAPK
    • DCAMKL
    • MAPKAPK
    • MLCK
    • PIM
    • PKD
    • RAD53
    • SgK495
    • Trbl
    • TSSK
    • More...
    • CK1
    • CSNK1A1/CK1a
    • CSNK1D/CK1d
    • CSNK1E/CK1e
    • CSNK1G1/CK1g1
    • CSNK1G2/CK1g2
    • CSNK1G3/CK1g3
    • TTBK
    • VRK
    • More...
    • CDK
    • CDKL
    • CK2
    • CLK
    • DYRK
    • GSK
    • MAPK
    • SRPK
    • More...
    • diacylglycerol kinase
    • PI3K
    • PI4K
    • PKL
    • SPHK
    • More...
    • EGFR/ErbB family
    • PKD
    • Trbl
    • VRK
    • PEAK
    • Janus kinase
    • Eph
    • Ror
    • IRAK
    • MLK
    • RAF
    • TKL-Unique
    • More...
    • STE11
    • STE7
    • STE-Unique
    • More...
    • EGFR/ErbB family
    • Abl
    • Ack
    • ALK
    • Axl
    • Csk
    • Eph
    • FAK
    • Fer
    • InsR
    • Jak
    • Met
    • Musk
    • Ret
    • Ror
    • Sev
    • Src
    • Syk
    • Tec
    • Tie
    • Trk
    • More...
    • IRAK
    • LISK
    • LRRK
    • MLK
    • RAF
    • RIPK
    • STKR
    • TKL-Unique
    • More...
    • Aur
    • BUB
    • CAMKK
    • CDC7
    • IKK
    • IRE
    • NAK
    • NEK
    • NKF1
    • NKF3
    • NKF4
    • PEK
    • PLK
    • SCY1
    • SgK071
    • Slob
    • TBCK
    • TLK
    • TOPK
    • TTK
    • ULK
    • WEE
    • WNK
    • More...
    • C1q
    • Complement Component 1s
    • More...
    • Complement Component 3a
    • More...
    • Complement Component 5a
    • More...
    • Complement Component 8 gamma Chain
    • More...
    • Mannose-binding Protein A
    • Mannose-binding Protein C
    • More...
    • DAF Protein/CD55
    • Complement Factor B
    • Factor D
    • Factor H
    • Complement Factor H Related 1
    • Complement Factor H Related 2
    • Complement Factor H Related 3
    • Complement Factor H Related 4
    • Complement Factor H Related 5
    • Complement Factor P
    • Vitronectin
    • HABP1/C1QBP
    • Membrane Cofactor Protein/CD46
    • CD59
    • More...
    • CD21/CR2
    • C5a Receptor/CD88
    • CD93
    • More...
    • Ubiquitin B (UBB)
    • Interferon-Stimulated Gene 15 (ISG15)
    • Ubiquitin-Like Protein FUBI
    • More...
    • E1 Enzymes
    • E2 Enzymes
    • E3 Ligases
    • More...
    • UCH Proteins
    • Ubiquitin-Specific Protease
    • Ovarian Tumour Domain Family DUBs
    • More...
    • SARS-CoV-2 Nucleocapsid Proteins
    • SARS-CoV-2 Spike Proteins
    • SARS-CoV-2 Non-structural Proteins
    • SARS-CoV-2 Plpro
    • SARS-CoV-2 3C-like Protease
    • SARS-CoV-2 RNA Dependent RNA Polymerase
    • More...
    • Zika Virus E proteins
    • Zika Virus Non-structural Protein 1
    • Zika Virus Non-structural Protein 5
    • More...
    • RSV Fusion Proteins
    • RSV G proteins
    • More...
    • Hepatitis C virus E1 Proteins
    • Hepatitis C virus E2 Proteins
    • More...
    • HIV-1 gp120
    • HIV-1 p24 Proteins
    • Gag-Pol Polyprotein
    • HIV-2 gp36 Proteins
    • HIV-1 gp140 Proteins
    • HIV-1 gp160
    • More...
    • HPV E6 Proteins
    • HPV E7 Proteins
    • More...
    • Influenza Hemagglutinin
    • Influenza Virus Neuraminidase
    • Hemagglutinin-Neuraminidase
    • Matrix Protein 1
    • Influenza Virus Nucleoprotein
    • Influenza Non-structural Protein 1
    • More...
    • DENV E Proteins
    • Dengue virus Capsid Proteins
    • DENV Non-structural Protein 1 (NS1)
    • Dengue Virus Non-structural Protein 5 (NS5)
    • More...
    • Ebola Virus GP Proteins
    • Ebola Virus GP1
    • Ebola Virus GP2
    • Ebola Virus NP
    • Ebola Viral Protein 24
    • Ebola Virus VP40
    • More...
    • Cytokines and Growth Factors
    • Immune Checkpoint Proteins
    • CAR-T Related Proteins
    • CD Antigens
    • Fc Receptors
    • Receptor Proteins
    • Enzymes & Regulators
    • Kinases
    • Complement System
    • Ubiquitin Related Proteins
    • Viral Proteins
    • Biotinylated Proteins
    • Fluorescent-labeled Recombinant Proteins
    • GMP-grade Proteins
    • Animal-free Recombinant Proteins
    • Isotope-Labeled Recombinant Proteins
    • Others
    • More...
    • Cytokines and Growth Factors
    • Immune Checkpoint Proteins
    • CAR-T Related Proteins
    • CD Antigens
    • Fc Receptors
    • Receptor Proteins
    • Enzymes & Regulators
    • Kinases
    • Complement System
    • Ubiquitin Related Proteins
    • Viral Proteins
    • Compound Screening Libraries
    • Screening Technology and Services
    • Virtual Screening
    • Lead Optimization
    • Equipment and Consumables
    • Customized Compound Library
    • Bioactive Compound Series
    • Natural Products Series
    • Fragment Libraries
    • Diversity Compound Libraries
    • Screening Technology and Services
    • Cell-based Compound Screening
    • High-Content Screening
    • Ion Channel Screening
    • Kinase Screening Services
    • Surface Plasmon Resonance (SPR) Assay Services
    • Molecular Docking
    • Molecular Dynamics Simulation
    • GPCR Bioassay Screening Services
    • Nuclear Receptor Screening Services
    • Affinity Mass Spectrometry
    • DEL Synthesis and Screening
    • mRNA Display Technology
    • SPRi High Throughput Screening
    • AI Driven Drug Screening
    • Molecular Interaction Assay Services
    • Drug Target Identification Services
    • Computer-aided Reverse Target Identification
    • Network Pharmacology / Network Toxicology Analysis
    • General Bioactive Screening Libraries
    • Drug Repurposing Series
    • Metabolism Focused Libraries
    • Signaling Pathway Targeting Libraries
    • Disease Focused Libraries
    • Structure Classified Libraries
    • Compound Characteristic Classified Libraries
    • Natural Product Screening Libraries
    • Traditional Chinese Medicine Libraries
    • Structure Classified Natural Product Libraries
    • Featured Fragment Libraries
    • Functional Fragment Libraries
    • According to Fragment Structures
    • Distinctive Diversity Libraries
    • Focused and target libraries
    • According to Lead-like Structures
    • DNA Encoded Libraries
    • AI-enabled Libraries
    • Novel Bioactive Compound Library
    • Targeted Diversity Library
    • Bioactive Compound Library Plus
    • Bioactive Compound Library
    • Multi-Target Compound Library
    • Bioactive Compound Library Max
    • Withdrawn Drug Compound Library
    • EMA-Approved Drug Library
    • Pediatric Drug Library
    • Drug Repurposing Compound Library
    • Drug Repurposing Compound Library Plus
    • Clinical Compound Library
    • Clinical Compound Library Plus
    • NMPA-Approved Drug Library
    • FDA-Approved Drug Library Mini
    • FDA-Approved Drug Library
    • FDA-Approved Drug Library Plus
    • FDA Approved & Pharmacopeial Drug Library
    • Off-patent Drug Library
    • FDA-Approved Anticancer Drug Library
    • Classic FDA-Approved Drug Library
    • Gut Microbial Metabolite Library
    • Human Metabolite Library
    • Human Endogenous Metabolite Compound Library
    • Microbial Metabolite Library
    • Mouse Metabolite Compound Library
    • Amino Acid Metabolite Compound Library
    • Nucleotide Metabolite Compound Library
    • Mass Spectrometry Human Metabolite Library
    • Mass Spectrometry Human Endogenous Metabolite Library
    • Lipid Metabolite Compound Library
    • Membrane Receptor-targeted Compound Library
    • Membrane Protein-targeted Compound Library
    • Coagulation and Anti-coagulation Compound Library
    • Osteogenesis Compound Library
    • Chemokine Compound Library
    • Nuclear Receptor Compound Library
    • 5-HT Receptor Compound Library
    • GABA Receptor Compound Library
    • Potassium Channel Compound Library
    • Sodium Channel Blocker Library
    • Calcium Channel Blocker Library
    • Oxygen Sensing Compound Library
    • Wnt/Hedgehog/Notch Compound Library
    • TGF-beta/Smad Compound Library
    • Stem Cell Signaling Compound Library
    • Protein Tyrosine Kinase Compound Library
    • PI3K/Akt/mTOR Compound Library
    • NF-κB Signaling Compound Library
    • Transcription Factor-Targeted Library
    • Neuronal Signaling Compound Library
    • Membrane Transporter/Ion Channel Compound Library
    • MAPK Compound Library
    • Kinase Inhibitor Library
    • Phosphatase Inhibitor Library
    • JAK/STAT Compound Library
    • Immunology/Inflammation Compound Library
    • Histone Modification Research Compound Library
    • Protein-protein Interaction Inhibitor Library
    • GPCR/G Protein Compound Library
    • Epigenetics Compound Library
    • Cell Cycle/DNA Damage Compound Library
    • Ubiquitination Compound Library
    • Reprogramming Compound Library
    • Differentiation Inducing Compound Library
    • Antioxidant Compound Library
    • Neurotransmitter Receptor Compound Library
    • Cytoskeleton Compound Library
    • Angiogenesis-Related Compound Library
    • Mitochondria-Targeted Compound Library
    • Endoplasmic Reticulum Stress Compound Library
    • Exosomes Compound Library
    • Mechanoreceptors Compound Library
    • TCA Cycle Compound Library
    • Cuproptosis Compound Library
    • Metabolism/Protease Compound Library
    • Glycolysis Compound Library
    • Autophagy Compound Library
    • Apoptosis Compound Library
    • Ferroptosis Compound Library
    • Glucose Metabolism Compound Library
    • Lipid Metabolism Compound Library
    • Glutamine Metabolism Compound Library
    • Pyroptosis Compound Library
    • Anti-Cancer Metabolism Compound Library
    • Cytokine Inhibitors Library
    • Mitophagy Compound Library
    • Lactic Acid Metabolite Compound Library
    • Epigenetics Compound Library Mini
    • Dopamine Receptor Compound Library
    • Ion Channel Compound Library
    • Energy Metabolites Library
    • Serine/Threonine Kinase Inhibitor Library
    • High-Efficiency Gene Editing Compound Library
    • Extracellular Vesicles (EVs) Compound Library
    • Cell Death Inhibitor Library Mini
    • RNA Binding Bioactive Compound Library
    • Cell Proliferation Compound Library
    • Metabolic Enzyme Compound Library
    • Lactylation Compound Library
    • Mitochondrial Protection Compound Library
    • KRAS Targeted Compound Library
    • Mitochondrial Toxicity Compound Library
    • Protease Inhibitor Library
    • Kinase Inhibitor Library Mini
    • Anti-tuberculosis Compound Library
    • Anti-Orthopoxvirus Compound Library
    • Pain-Related Compound Library
    • Antibacterial Compound Library
    • Anti-Pulmonary Fibrosis Compound Library
    • Antidepressant Compound Library
    • Endocrinology Compound Library
    • Antifungal Compound Library
    • Rare Diseases Drug Library
    • Anti-Cardiovascular Disease Compound Library
    • Anti-Prostate Cancer Compound Library
    • Anti-diabetic Compound Library
    • Anti-Colorectal Cancer Compound Library
    • Anti-Aging Compound Library
    • Anti-Liver Cancer Compound Library
    • Anti-Pancreatic Cancer Compound Library
    • Anti-Parkinson's Disease Compound Library
    • Anti-Alzheimer's Disease Compound Library
    • Neurodegenerative Disease-related Compound Library
    • Antiviral Compound Library
    • Antiparasitic Compound library
    • Anti-Infection Compound Library
    • Antiviral Traditional Chinese Medicine Active Compound Library
    • Anti-Breast Cancer Compound Library
    • Anti-Lung Cancer Compound Library
    • Anti-Blood Cancer Compound Library
    • Targeted Therapy Drug Library
    • Anti-Cancer Natural Product Library
    • Anti-Hepatitis C Virus Compound Library
    • Small Molecule Immuno-Oncology Compound Library
    • Anti-Cancer Compound Library
    • Anti-COVID-19 Compound Library
    • Antihypertensive Compound Library
    • Chemotherapy Drug Library
    • Anti-Obesity Compound Library
    • FDA-Approved Anticancer Drug Library
    • Anti-inflammatory Traditional Chinese Medicine Active Compound Library
    • Non-steroidal Anti-Inflammatory Compound Library
    • Anti-Fibrosis Compound Library
    • Anti-Ovarian Cancer Compound Library
    • Anti-Aging Compound Library Mini
    • Anti-Aging Natural Product Library
    • Anti-Gastric Cancer Compound Library
    • Autoimmune Disease Compound Library
    • Anti-Hematopathy Compound Library
    • Cyclic Peptide Library
    • Peptide Library
    • Nucleotide Compound Library
    • Lipid Compound Library
    • Glycoside Compound Library
    • Heterocyclic Compound Library
    • Macrocyclic Compound Library
    • Covalent Screening Library Plus
    • Covalent Screening Library
    • Peptidomimetic Library
    • Cysteine Targeted Covalent Library
    • Boronic Acid Compound Library
    • Peptide Compound Library
    • Dipeptide Compound Library
    • Fatty Acids Compound Library
    • Cysteine Targeted Covalent Fragment Library
    • Ionizable Lipid Compound Library
    • PROTAC Library
    • Molecular Glue Compound Library
    • Tumorigenesis-Related Compound Library
    • Drug Metabolite Library
    • Animal Disease Model Inducer Library
    • Inactive Ingredient Library
    • Chemical Probe Library
    • Orally Active Compound Library
    • CNS-Penetrant Compound Library
    • Toxins for Antibody-Drug Conjugate Research Library
    • Food-Sourced Compound Library
    • Food Additive Library
    • Drug-Induced Liver Injury (DILI) Compound Library
    • Target Protein Ligand Library
    • E3 Ligase Ligand Library
    • Antibiotics Library
    • Neuroprotective Compound Library
    • Non-steroidal Anti-Inflammatory Compound Library
    • Macrophage Related Compound Library
    • Radiosensitizer Library
    • Alkyne Compound Library
    • Immunopotentiator Compound Library
    • Cancer Stem Cells Compound Library
    • Antibody Inhibitor Library
    • Flavors and Fragrances Compound Library
    • Highly Selective Inhibitors Library
    • Anti-Drug-Resistant Compound Library
    • Inflammasomes related Compound Library
    • Azide Compound Library
    • Radioprotector Library
    • Neurotransmitter Compound Library
    • Steroid Hormones Library
    • Chinese Baijiu Compound Library
    • Mitochondrial Toxicity Compound Library
    • Cell Death Library
    • Environmental Pollutant Compound Library
    • Plant Hormone Library
    • Pesticide Compound Library
    • Allosteric Modulators (AMs) Compound Library
    • Anti-Cancer Natural Product Library
    • Plant-Sourced Natural Product Library
    • Natural Product-like Compound Library
    • Natural Product Library Plus
    • Natural Product Library
    • Marine-Sourced Natural Product Library
    • Microbial Metabolite Library
    • Fungal-Sourced Compound Library
    • Animal-Sourced Natural Product Library
    • Mass Spectrometry Natural Product Library
    • Anti-Aging Natural Product Library
    • Bacteria-Sourced Compound Library
    • Natural Product Diversity Scaffold Library
    • Antiviral Traditional Chinese Medicine Active Compound Library
    • Traditional Chinese Medicine Active Compound Library
    • Medicine Food Homology Compound Library
    • Anti-inflammatory Traditional Chinese Medicine Active Compound Library
    • Antitussive and Antiasthmatic Traditional Chinese Medicine Active Compound Library
    • Diarrhea-Related Traditional Chinese Medicine Active Compound Library
    • Tonifying Traditional Chinese Medicine Monomer Compound Library
    • FDA-Approved Traditional Chinese Medicine Active Compound Library
    • Phenols Library
    • Terpenoids Library
    • Alkaloids Library
    • Flavonoids Library
    • Quinones Library
    • 3D Diverse Fragment Library
    • Fragment Library
    • Drug Fragment Library
    • CRBN Ligand Library
    • Multifunctional Covalent Fragment Library
    • Molecular Glue POI binding Fragment library
    • Structurally Diverse Fragment Library
    • Allosteric Modulator Fragment Library
    • Unnatural Amino Acids Fragment library
    • Tyrosine Focused Covalent Fragment Library
    • Advanced Macrocyclization Linker Library
    • Serine/Threonine Focused Covalent Fragment Library
    • Lysine Focused Covalent Fragment Library
    • MCE Kinase Hinge Binder Fragment Library
    • Covalent Fragment Library
    • Cysteine Targeted Covalent Fragment Library
    • Fragment Library with Good Solubility
    • Electrophilic Heterocyclic Fragment Library
    • Boronic acid/boronic ester fragment library
    • Sulfonyl Fluoride Fragment Library
    • F-Fragments Library
    • 5K Scaffold Library
    • 50K Diversity Library
    • Natural Product-like Compound Library
    • Lead-like Diversity Library Plus
    • Allosteric Modulator Lead‑like Compound Library
    • MCE‑18 Novelty Focused Drug‑Like Library
    • 10K Golden Scaffold Library
    • MCE‑18 Novelty drug‑like Library
    • Good ADMET Diversity Library
    • Norepinephrine Transporter (NET) Compound Library
    • Molecular Glue-like Compound Library
    • Antibacterial Lead-like compound library
    • GPCR Targeted Diversity Library
    • Antiviral Lead-like compound library
    • Cysteine Protease Focused Library
    • PD-1/PD-L1 Lead-like Library
    • MCE CNS BBB Lead-like Library
    • Ion Channel Lead-like Compound Library
    • CNS MPO Lead-like Library
    • RNA Binding Library
    • Cysteine Protease Focused Covalent Library
    • Antifungal Lead-like compound library
    • Lead-like Covalent Screening Library
    • 7-Membered Ring Privileged Scaffold Lead-like Library
    • Spirocyclic Privileged Scaffold Lead-like Library
    • DEL Covalent Library
    • DEL B Kit Regular Library
    • DEL D Kit Cyclic Peptide Library
    • Kinase Macrocyclic Compound Virtual Library
    • MegaUni 10M Virtual Diversity Library
    • Molecular Glue Virtual Library
    • Bioactive Compound Series
      • General Bioactive Screening Libraries
      • Drug Repurposing Series
      • Metabolism Focused Libraries
      • Signaling Pathway Targeting Libraries
      • Disease Focused Libraries
      • Structure Classified Libraries
      • Compound Characteristic Classified Libraries
      Natural Products Series
      • Natural Product Screening Libraries
      • Traditional Chinese Medicine Libraries
      • Structure Classified Natural Product Libraries
      Fragment Libraries
      • Featured Fragment Libraries
      • Functional Fragment Libraries
      • According to Fragment Structures
      Diversity Compound Libraries
      • Distinctive Diversity Libraries
      • Focused and target libraries
      • According to Lead-like Structures
      • DNA Encoded Libraries
      • AI-enabled Libraries
    • Screening Technology and Services
      • Cell-based Compound Screening
      • High-Content Screening
      • Ion Channel Screening
      • Kinase Screening Services
      • Surface Plasmon Resonance (SPR) Assay Services
      • Molecular Docking
      • Molecular Dynamics Simulation
      • GPCR Bioassay Screening Services
      • Nuclear Receptor Screening Services
      • Affinity Mass Spectrometry
      • DEL Synthesis and Screening
      • mRNA Display Technology
      • SPRi High Throughput Screening
      • AI Driven Drug Screening
      • Molecular Interaction Assay Services
      • Drug Target Identification Services
      • Computer-aided Reverse Target Identification
      • Network Pharmacology / Network Toxicology Analysis
    • Virtual Screening
    • Lead Optimization
    • Equipment and Consumables
    • Customized Compound Library
    Customized Compound Libraries
    • 01 Specific Compounds
    • 02 Quantities
    • 03 Plate Map
    • 04 Concentration
    • 05 Form (Solid or Solution)
    • YES
    Contact Us for Customization
    • Cancer
    • Infection
    • Neurological, Eye or Ear Disease
    • Inflammation or Immune System Disease
    • Blood or Cardio-cerebrovascular Disease
    • Metabolic or Endocrine Disease
    • Respiratory Disease
    • Digestive System Disease
    • Urogenital Disease
    • Musculoskeletal and Skin Disease
    • Others
    • Lung Cancer
    • Breast Cancer
    • Colorectal Cancer
    • Prostate Cancer
    • Gastric Cancer
    • Liver Cancer
    • Thyroid Cancer
    • Cervical Cancer
    • Bladder Cancer
    • Leukemia/Lymphoma/Myeloma
    • Pancreatic Cancer
    • Melanoma
    • Ovarian Cancer
    • Glioma
    • Neuroblastoma
    • Osteosarcoma
    • More...
    • Viral Infection
    • Coronavirus Infection
    • HIV Infection
    • Hepatitis Virus Infection
    • Bacterial Infection
    • Fungal Infection
    • Parasitic Infection
    • Plant Infection
    • More...
    • Neurodegenerative Disease
    • Cerebrovascular Disease
    • Schizophrenia
    • Depression
    • Epilepsy
    • Anxiety or Fear-Related Disease
    • Pain
    • Neurotrophic or Neurotoxic Disease
    • CNS Infection
    • CNS Neoplasm
    • Nervous System Injury
    • Attention Deficit Hyperactivity Disorder
    • Behavioral Addiction
    • Sleep-Wake Disorder
    • Visual System Disease
    • Ear Disease
    • More...
    • Autoimmune Disease
    • Immunodeficiency Disease
    • Allergy
    • Cancer Immunology
    • Vaccine and Immunization
    • Immunomodulation
    • Skin Inflammation
    • Pathogens Infection
    • Oxidative Stress and Inflammation
    • Chronic Disease and Inflammation
    • Respiratory Inflammation
    • Digestive System Inflammation
    • Genitourinary Inflammation
    • More...
    • Cerebrovascular Disease
    • Cardiovascular Disease
    • Blood Disease
    • Heart Disease
    • More...
    • Glucose Metabolism
    • Lipid Metabolism
    • Amino Acid/Protein Metabolism
    • Mineral Metabolism
    • Purine Metabolism
    • Hypothalamic-Pituitary-Adrenal Regulation
    • Thyroid Disease
    • Gonadal Disease
    • Parathyroid Disease
    • Energy Metabolism
    • Dietary Supplement
    • More...
    • Upper Respiratory Inflammation
    • Lower Respiratory Inflammation
    • Pulmonary Disease
    • Respiratory Cancer
    • More...
    • Digestive System Cancer
    • Gastric Disease
    • Peptic Ulcer Disease
    • Liver Disease
    • Constipation
    • More...
    • Urologic Disease
    • Renal Disease
    • Male Reproductive System Disease
    • Female Reproductive System Disease
    • Urogenital Cancer
    • Sexually Transmitted Disease
    • More...
    • Arthritis
    • Spinal Disease
    • Muscle Disease
    • Osteogenic Differentiation
    • Skin Disease
    • More...
    • Cancer
    • Infection
    • Neurological, Eye or Ear Disease
    • Inflammation or Immune System Disease
    • Blood or Cardio-cerebrovascular Disease
    • Metabolic or Endocrine Disease
    • Respiratory Disease
    • Digestive System Disease
    • Urogenital Disease
    • Musculoskeletal and Skin Disease
    • Others
    • Molecular Biology
    • Protein Biology
    • Cell Biology
    • Biological Laboratory Consumables
    • Nucleic Acid Gel Electrophoresis
    • Vector Construction
    • Restriction Endonuclease
    • Materials
    • PCR & qPCR
    • RT-PCR
    • Sequencing
    • Protein Sample Preparation
    • Protein Purification
    • Protein Electrophoresis & WB
    • Multiple Fluorescent Staining
    • Immunoassay
    • Immunoprecipitation Kit
    • Labeling Kit
    • Cell Culture
    • Cell Analysis
    • 3D Cell Culture
    • Cell Isolation
    • Sample Storage
    • Nucleic Acid Gel Stain
    • Agarose
    • Loading & Running Buffer
    • DNA Marker
    • Seamless Cloning
    • Ligase
    • Endonuclease
    • Polymerase Chain Reaction (PCR)
    • Real-Time PCR
    • DNA Polymerase
    • Direct PCR
    • Reverse transcription PCR
    • RNase Inhibitor
    • Enzymes
    • Cell Lysis
    • Washing Buffer
    • Protease Inhibitor Cocktail
    • Phosphatase Inhibitor Cocktail
    • Deacetylase Inhibitor Cocktail
    • Kinase Inhibitor Cocktail
    • Protein Assay
    • Magnetic Stand
    • Magnetic Beads
    • Affinity Chromatography Column
    • Agarose Beads
    • Equilibration Buffer
    • Magnetic Agarose Beads
    • Electrophoresis Buffer
    • Protein Marker
    • Transfer Buffer
    • Blocking Buffer
    • Binding/Washing Buffer
    • Chemiluminescent Detection
    • Loading Buffer
    • Protein Staining Solution
    • Gel Preparation Kit
    • Antibody Dilution Buffer
    • Protein Gel
    • Cell Transfection
    • Mycoplasma Clearance
    • Sterile Antibiotic Solution
    • Cell Freezing
    • CEPT cocktail
    • Basal Cell Culture Media
    • Balanced Salt Solutions
    • Cell Culture Supplements
    • Dissociation Reagents
    • Cell Separation Media
    • Specialized Cell Culture Medium
    • Lentivirus
    • Cell Proliferation and Cytotoxicity
    • Reporter Gene Testing
    • Phalloidin Dye Conjugates
    • Cell Apoptosis and Necrosis
    • AntiFade Mounting Medium
    • Mitochondrial Isolation
    • Exosome Isolation, Purification and Detection
    • Organelle Research
    • Metabolism Assay Kit
    • Mycoplasma Detection
    • Biochemical Assay Kit
    • Endotoxin Detection
    • Staining Kit
    • Basement Membrane Matrix
    • Tumor Organoid Culture Medium
    • Normal Tissue Organoid Culture Medium
    • Organoid Research
    • PSC Induction Product Series
    • SYBR Green I Nucleic Acid Gel Stain
    • Red Nucleic Acid Gel Stain (10,000×)
    • Agarose With TAE Powder (1%)
    • Agarose
    • TAE Powder (1 L of 1×)
    • TBE Powder (1 L of 1×)
    • 6× DNA Loading Buffer with SDS
    • 50 bp DNA Marker
    • 100 bp DNA Marker
    • 100 bp plus DNA Marker
    • 500 bp DNA Marker
    • 1 kb DNA Marker
    • 2 kb DNA Marker
    • 5 kb DNA Marker
    • 15 kb DNA Marker
    • Seamless DNA Assembly Plus Kit
    • Seamless DNA Assembly Ultra Kit
    • T4 DNA Ligase (Fast)
    • Taq DNA Ligase
    • T7 Endonuclease I
    • Exonuclease I
    • Protein Deglycosylation Kit (for N-Linked & Simple O-Linked Glycans)
    • 2× PCR Master Mix (with Dye)
    • 2× Fast PCR Master Mix (with Dye)
    • 2× High-Fidelity PCR Master Mix
    • 2× High-Fidelity PCR Master Mix (with Dye)
    • SYBR Green qPCR Master Mix
    • SYBR Green qPCR Master Mix (Universal)
    • SYBR Green qPCR Master Mix (High ROX)
    • SYBR Green qPCR Master Mix (Low ROX)
    • SYBR Green qPCR Master Mix (No ROX)
    • 2-Color Tracking SYBR qPCR Master Mix (Universal)
    • Phi29 DNA Polymerase
    • Bst DNA Polymerase, Full Length
    • Bst DNA Polymerase, Large Fragment
    • DNA Polymerase I(E.coli)
    • T4 DNA Polymerase
    • Phi29 DNA Polymerase(mutant)
    • Mouse Tissue Lysis Buffer
    • Mouse Tissue Direct PCR Kit (with Dye)
    • Mouse Tissue Direct PCR Plus Kit
    • Mouse Tissue Direct PCR Kit – Pro (with Dye)
    • Blood Direct PCR Kit (with Dye)
    • Animal Tissue Direct PCR Kit (with Dye)
    • Plant Tissue Direct PCR Kit (with Dye)
    • RT Master Mix for qPCR II
    • RT Master Mix for qPCR (gDNA digester plus)
    • RT Master Mix for qPCR II (gDNA digester plus)
    • microRNA RT Master Mix for qPCR Ⅲ (poly A)
    • RT Master Mix for qPCR III
    • Reverse Transcriptase
    • RNase Inhibitor
    • Terminal Deoxynucleotidyl Transferase (TdT)
    • Bacterial Protein Extraction Reagent
    • WB/IP Lysis Buffer
    • RIPA Lysis Buffer (Strong)
    • NP-40 Lysis Buffer
    • Mammalian Active Protein Extraction Reagent
    • Red Blood Cell Lysis Buffer (10×)
    • PBS Powder (1 L of 1×)
    • PBS Powder (2 L of 1×)
    • TBS Powder (1 L of 1×)
    • PMSF (100×)
    • Protease Inhibitor Cocktail (EDTA-Free, 100× in DMSO)
    • Protease Inhibitor Cocktail, mini-Tablet (EDTA-Free)
    • Protease Inhibitor Cocktail, Bacteria (EDTA-Free, 100× in DMSO)
    • Protease and Phosphatase Inhibitor Cocktail (EDTA-Free, 10× in ddH2O)
    • Phosphatase Inhibitor Cocktail I (100× in DMSO)
    • Phosphatase Inhibitor Cocktail Ⅱ (100× in ddH2O)
    • Phosphatase Inhibitor Cocktail Ⅲ (100× in DMSO)
    • Deacetylase Inhibitor Cocktail (100× in 70% DMSO)
    • Kinase Assay Buffer
    • Kinase Inhibitor Cocktail
    • Bradford Protein Assay Kit
    • BCA Protein Assay Kit
    • Magnetic Stand Plus
    • Anti-HA Magnetic Beads
    • Anti-HA Magnetic Beads (1 μm)
    • Protein A/G Magnetic Beads
    • Protein A Magnetic Beads
    • Protein G Magnetic Beads
    • Protein L Magnetic Beads
    • Anti-c-Myc Magnetic Beads
    • Anti-Flag Magnetic Beads
    • Streptavidin Magnetic Beads
    • Anti-His Magnetic Beads
    • Anti-GST Magnetic Beads
    • Hydroxyl Magnetic Beads (200 nm, 10 mg/mL)
    • Amino Magnetic Beads (200 nm, 10 mg/mL)
    • Carboxyl Magnetic Beads (200 nm, 10 mg/mL)
    • CHO Magnetic Beads (200 nm, 10 mg/mL)
    • NHS Magnetic Beads (200nm, 10 mg/mL)
    • Oligo (dT)30 Magnetic Beads
    • ConA Magnetic Beads
    • Anti-V5 Magnetic Beads
    • Anti-MBP Magnetic Beads
    • Affinity Chromatography Column
    • Ni-NTA His-Tag Purification Agarose
    • Glutathione Agarose
    • Protein A Agarose
    • Protein G Agarose
    • Protein L Agarose
    • Anti-Flag Affinity Gel
    • Streptavidin Agarose 6FF
    • High-Affinity Iodoacetyl Agarose
    • Ni-NTA 6FF Prepacked Column
    • Anti-GFP Affinity Gel
    • Protein A/G Agarose
    • Anti-c-Myc Affinity Gel
    • Anti-HA Affinity Gel
    • Anti-RFP Affinity Gel
    • Anti-YFP Affinity Gel
    • Ni-IDA Agarose
    • Streptavidin-Binding Peptide Tag Agarose
    • Protein A Agarose (Alkali-Tolerant) 4FF
    • MBP Agarose (Dextrin) 6FF
    • Heparin Agarose 6FF
    • Blue Agarose 6FF
    • IMAC Agarose (NTA) 6FF
    • Chelating Agarose (IDA) 6FF
    • CM Agarose 6FF
    • SP Agarose 6FF
    • DEAE Agarose 6FF
    • Q Agarose 6FF
    • SP Agarose HP
    • DEAE Agarose HP
    • Q Agarose HP
    • Butyl Agarose 4FF
    • Butyl Agarose HP
    • Octyl Agarose 6FF
    • Octyl Agarose HP
    • Phenyl Agarose (Low Sub) 6FF
    • Phenyl Agarose (High Sub) 6FF
    • Phenyl Agarose HP
    • ConA Agarose
    • PBS Powder (1 L of 1×)
    • PBS Powder (2 L of 1×)
    • Glutathione Magnetic Agarose Beads
    • Anti-Flag Magnetic Agarose Beads
    • Anti-HA Magnetic Agarose Beads
    • Ni-IDA Magnetic Agarose Beads
    • Ni-NTA Magnetic Agarose Beads
    • Protein A Plus Magnetic Agarose Beads
    • Protein G Plus Magnetic Agarose Beads
    • Anti-GFP Magnetic Agarose Beads
    • Tris-MES-SDS Powder (1 L of 1×)
    • Tris-MOPS-SDS Powder (1 L of 1×)
    • Tris-Glycine-SDS Powder (1 L of 1×)
    • SDS dust-free Powder
    • Tris-HEPES-SDS Powder (500 mL of 1×)
    • 3-Color Prestained Protein Marker (10-190 kDa)
    • 3-Color Prestained Protein Marker (10-180 kDa)
    • 3-Color Prestained Protein Marker (2.7-40 kDa)
    • Tris-Glycine Powder (1 L of 1×)
    • Transfer Buffer (Semi Dry) Powder (1 L of 1×)
    • Rapid Protein Transfer Buffer, No Ice Bath Required (10×)
    • Rapid Blocking Buffer (TBS-T) Powder (100 mL of 1×)
    • PBS-T Powder (1 L of 1×)
    • TBS-T Powder (1 L of 1×)
    • Ultra High Sensitivity ECL Kit
    • High Sensitivity ECL Kit
    • Sensitive ECL Kit
    • SDS-PAGE Sample Loading Buffer (4×)
    • SDS-PAGE Protein Loading Buffer (non-Reducing, 5×)
    • Coomassie Blue Fast Staining Solution (No Heating, 10×)
    • Ponceau Staining Solution (Ready-to-use, 1×)
    • One Step Colored Rapid Gel Preparation Kit (12.5%)
    • Antibody Dilution Buffer (for Western Blot)
    • Antibody Dilution Buffer (for Immunohistochemistry, IHC)
    • Antibody Dilution Buffer (for Immunostaining)
    • GelHP Protein Gel (Tris-Gly, 10%, 10 well)
    • GelHP Protein Gel (Tris-Gly, 10%, 15 well)
    • GelHP Protein Gel (Tris-Gly, 12%, 10 well)
    • GelHP Protein Gel (Tris-Gly, 12%, 15 well)
    • GelHP Protein Gel (Tris-Gly, 15%, 10 well)
    • GelHP Protein Gel (Tris-Gly, 15%, 15 well)
    • GelHP Protein Gel (Tris-Gly, 4-15%, 10 well)
    • GelHP Protein Gel (Tris-Gly, 4-15%, 15 well)
    • GelHP Protein Gel (Tris-Gly, 4-20%, 10 well)
    • GelHP Protein Gel (Tris-Gly, 4-20%, 15 well)
    • GelHP Protein Gel (Tris-Gly, 8-16%, 10 well)
    • GelHP Protein Gel (Tris-Gly, 8-16%, 15 well)
    • GelHP Protein Gel (Tris-Gly, 8-20%, 10 well)
    • GelHP Protein Gel (Tris-Gly, 8-20%, 15 well)
    • GelHP Protein Gel (Bis-Tris, 10%, 10 well)
    • GelHP Protein Gel (Bis-Tris, 10%, 15 well)
    • GelHP Protein Gel (Bis-Tris, 12%, 10 well)
    • GelHP Protein Gel (Bis-Tris, 12%, 15 well)
    • GelHP Protein Gel (Bis-Tris, 15%, 10 well)
    • GelHP Protein Gel (Bis-Tris, 15%, 15 well)
    • GelHP Protein Gel (Bis-Tris, 4-15%, 10 well)
    • GelHP Protein Gel (Bis-Tris, 4-15%, 15 well)
    • GelHP Protein Gel (Bis-Tris, 4-20%, 10 well)
    • GelHP Protein Gel (Bis-Tris, 4-20%, 15 well)
    • GelHP Protein Gel (Bis-Tris, 8-16%, 10 well)
    • GelHP Protein Gel (Bis-Tris, 8-16%, 15 well)
    • GelHP Protein Gel (Bis-Tris, 8-20%, 10 well)
    • GelHP Protein Gel (Bis-Tris, 8-20%, 15 well)
    • GelHP Protein Gel (Tris-Gly, 8%, 10 well)
    • GelHP Protein Gel (Tris-Gly, 8%, 15 well)
    • GelHP Protein Gel (Bis-Tris, 8%, 10 well)
    • GelHP Protein Gel (Bis-Tris, 8%, 15 well)
    • PolyFast Transfection Reagent
    • PEI Transfection Reagent
    • Lentivirus Transfection Reagent
    • Protein Transfection Reagent
    • siRNA/miRNA Transfection Reagent
    • OptiLNP RNA Transfection Reagent
    • OptiLNP RNA Transfection Reagent (Stem Cells)
    • OptiLNP RNA Transfection Reagent (Primary Immune Cells)
    • OptiLNP RNA Transfection Reagent (Immune Cells)
    • In vivo OptiLNP RNA Transfection Reagent (Systemic Effect)
    • In vivo OptiLNP RNA Transfection Reagent (Local Effect)
    • In vivo OptiLNP RNA Transfection Reagent (Liver-targeted)
    • In vivo OptiLNP RNA Transfection Reagent (Lung-targeted)
    • OptiLNP Short-Chain RNA Transfection Reagent
    • OptiLNP Gene Editing Kit
    • OptiLNP Gene Editing Kit (Immune Cells)
    • HP PolyFast Transfection Reagent
    • OptiLNP Antibody-ctLNP pDNA Transfection Reagent (Jurkat Cells)
    • OptiLNP Antibody-ctLNP RNA Transfection Reagent (Human Primary T Cells)
    • Fluc mRNA (N1-Me-pUTP)
    • BM-Cyclin
    • Penicillin-Streptomycin-Neomycin (PSN) (100×), Sterile
    • Penicillin-Streptomycin (100×), Sterile
    • Gentamicin-Amphotericin B (500×), Sterile
    • Penicillin-Streptomycin-Glutamine (100×), Sterile
    • Polymyxin B (1,000×), Sterile
    • Gentamicin, Sterile
    • Hygromycin B, Sterile
    • Amphotericin B, Sterile
    • Blasticidin S, Sterile
    • Kanamycin sulfate (100x), Sterile
    • G418 Selective Antibiotic, Sterile
    • Puromycin, Sterile
    • Antibiotic-Antifungal (100 ×), Sterile
    • Serum/Protein-Free Cell Freezing Medium
    • Stem Cell Cryopreservation Medium
    • CEPT Cocktail
    • Polyamine Supplement (1000×)
    • CEPT Cocktail Plus (1000×)
    • DMEM (High Glucose, L-Glutamine, Pyruvate, Phenol Red, no HEPES)
    • DMEM/F-12 (1:1), L-Glutamine, Phenol Red, HEPES
    • DMEM (Low Glucose, L-Glutamine, Pyruvate, Phenol Red, no HEPES)
    • RPMI 1640 (L-Glutamine, Phenol Red, no HEPES)
    • Minimum Essential Medium (MEM)
    • MEM Reduced Serum Medium for Transfection (Phenol Red)
    • Advanced DMEM/F-12, no L-Glutamine, no HEPES
    • Ham's F-12K (Kaighn's)
    • IMDM (Iscove's Modified Dulbecco's Medium)
    • McCoy’s 5A (Modified) Medium
    • DMEM/F-12 (1:1) Medium (with L-Alanyl-L-Glutamine and HEPES)
    • MEM-α Medium, no Nucleosides
    • MEM-α Medium (with Nucleosides)
    • Ham's F-12 Medium (with Phenol Red and L-Alanyl-L-Glutamine)
    • Advanced DMEM Reduced-Serum Medium, no L-Glutamine, no HEPES
    • Advanced MEM Reduced-Serum Medium, no L-Glutamine, no HEPES
    • Leibovitz's L-15 Medium
    • Medium 199 (with Earle's Balanced Salts)
    • PBS Buffer (1×)
    • PBS Buffer (10×)
    • DPBS Buffer (1×)
    • HBSS, Phenol Red, no Calcium, no Magnesium
    • HBSS, Phenol Red, Calcium, Magnesium
    • HBSS, Calcium, Magnesium, no Phenol Red
    • HBSS, no Calcium, no Magnesium, no Phenol Red
    • L-Glutamine (100×), Sterile
    • L-Alanyl-L-Glutamine (100×)
    • HEPES (1 M, Cell Culture Grade)
    • MEM Non-essential Amino Acid Solution (100×)
    • N-2 Supplement (100×), Sterile
    • N-2 Serum-free Supplement (100×)
    • Bi-27 Supplement (50×), Sterile
    • Bi-27 Serum-free Supplement (50×)
    • Bi-27 Supplement (50×), Vitamin A-Free, Sterile
    • Bi-27 Serum-free Supplement (50×), Vitamin A-Free
    • Bi-27 Serum-free Supplement (50×), Insulin-Free
    • Bi-27 Serum-free Supplement (50×), Antioxidant-Free
    • HAT Supplement (50×)
    • HT Supplement (50×)
    • ITS Supplement (100×)
    • Lipid Concentrate (Chemically Defined)
    • Recombinant Human Serum Albumin Solution (rHSA, 20%)
    • Sodium Pyruvate Solution (100 mM)
    • D-Glucose Solution (200 g/L)
    • MEM Vitamine Solution (100×)
    • G-5 Supplement (100×)
    • Sodium Bicarbonate Solution (7.5%)
    • Exosome-Specific 293 Cell Medium Supplement
    • 0.25% Trypsin-EDTA (1x), phenol red
    • 0.25% Trypsin-EDTA (1×), no phenol red
    • Red Blood Cell Lysis Buffer (10×)
    • Versene Solution
    • iPSC/ESC Dissociation Solution (Enzyme-Free)
    • ECM Gentle Dissociation Solution
    • Cardiomyocyte Dissociation Solution
    • Density Gradient Medium (Iodixanol)
    • Cell Separation Medium (Density Gradient)
    • Human Neuroblastoma Cell Culture Medium
    • Human Acute Myeloid Leukemia Cell Culture Medium
    • T-Cell Expansion Medium (Serum-Free)
    • Exosome-Specific Culture Medium (Serum-Free, Phenol Red-Free)
    • Exosome-Specific Mesenchymal Stem Cell Medium (Serum-Free, Phenol Red-Free)
    • Exosome-Specific 293 Cell Medium (Serum-Free)
    • Exosome-Specific 293 Cell Medium Supplement
    • Human PSC Maintenance Medium
    • Lentivirus Solution Buffer
    • Lentivirus Transfection Reagent
    • Lentivirus Packaging Kit
    • Lentivirus Concentration Solution (5×)
    • Polybrene (10 mg/mL)
    • Cell Counting Kit-8
    • Cell-ATP Viability Detection Kit
    • Cytotoxicity LDH Assay Kit
    • Viability/Cytotoxicity Assay Kit for Live & Dead Cells (Calcein/PI)
    • Live & Dead Bacterial Viability and Counting Kit
    • Trypan Blue Staining Solution (0.4%)
    • 3D Cell-ATP Viability Detection Kit
    • Renilla-Firefly Luciferase Dual Assay Kit
    • AMCA Phalloidin
    • Fluorescein Phalloidin
    • Rhodamine Phalloidin
    • JC-1 Mitochondrial Membrane Potential Assay Kit
    • Apoptosis and Necrosis Assay Kit
    • Cell Cycle and Apoptosis Analysis Kit (PI staining)
    • Cell Apoptosis Analysis Kit (Hoechst staining)
    • Annexin V-FITC/PI Apoptosis Detection Kit
    • Annexin V-PE Apoptosis Detection Kit
    • Annexin V-mCherry Apoptosis Detection Kit
    • Annexin V-mCherry/SYTOX Green Apoptosis Detection Kit
    • One Step TUNEL Apoptosis Detection Kit (FITC)
    • One Step TUNEL Apoptosis Detection Kit (Cyanine 3)
    • Annexin V-iFluor 488/PI Apoptosis Detection Kit
    • VF 488 Caspase 3 Assay Kit for Live Cells
    • Cell Senescence β-Galactosidase Staining Kit
    • Biotin Apoptosis Detection Kit (TUNEL)
    • YO-PRO-1/PI Apoptosis and Necrosis Detection Kit
    • VF 647A-Annexin V/PI Apoptosis Detection Kit
    • Annexin V-FITC/7-AAD Apoptosis Detection Kit
    • AntiFade Mounting Medium
    • AntiFade Mounting Medium (with DAPI)
    • AntiFade Reagent (with DAPI)
    • Mitochondria Isolation Kit for Cultured Cells
    • Mitochondria Isolation Kit for Tissue
    • Exosome Protein Lysis Buffer
    • Exosome Isolation and Purification Kit (from cell culture media)
    • Exosome Isolation and Purification Kit (from plasma and serum)
    • Exosome Isolation and Purification Plus Kit (From Plasma and Serum)
    • Exosome Protein Detection Kit (CD63 & TSG101)
    • Exosome Isolation and Purification Kit (from body fluids)
    • Exosome Purification Filter
    • Exosome Isolation and Purification Kit (From Tissue)
    • Exosome Protein Detection Kit (CD81)
    • Exosome Isolation and Purification Kit (From Milk)
    • Exosome-Specific Culture Medium (Serum-Free, Phenol Red-Free)
    • Exosome-Specific Mesenchymal Stem Cell Medium (Serum-Free, Phenol Red-Free)
    • Exosome-Specific 293 Cell Medium (Serum-Free)
    • Exosome-Specific 293 Cell Medium Supplement
    • Exosome Preservation Solution (Chemically Defined)
    • Serum/Plasma Exosome Isolation and Purification Kit (Magnetic Beads)
    • Bacterial Membrane Vesicle Isolation and Purification Kit
    • Dry Plant-Derived Extracellular Vesicle Isolation and Purification Kit
    • Succulent Plant-Derived Extracellular Vesicle Isolation and Purification Kit
    • Macrofungal-Derived Extracellular Vesicle Isolation and Purification Kit
    • Extracellular Vesicle (EV) Ultrafiltration Concentrator (500 μL, 100 kDa)
    • Halo Green Kit
    • Mito Red Kit
    • Tubulin Deep Red Kit
    • GSH/GSSG Assay Kit
    • NAD+/NADH Assay Kit (WST-8)
    • ATP Assay Kit
    • Nitric Oxide Detection Kit
    • Lipid Peroxidation (MDA) Assay Kit
    • ROS Assay Kit
    • Fumarase Activity Assay Kit (WST-8)
    • Cell Ferrous Iron (Fe2+) Assay Kit (Fluorometric)
    • Total Superoxide Dismutase (SOD) Activity Colorimetric Assay Kit (Xanthine Oxidase-NBT Method)
    • Total Superoxide Dismutase (SOD) Activity Colorimetric Assay Kit (WST-8 Method)
    • NADP+/NADPH Assay Kit (WST-8)
    • Caspase 1 Activity Assay Kit
    • Caspase 3 Activity Assay Kit
    • Mycoplasma Detection Kit (Luminescence)
    • Mycoplasma Detection Kit (PCR)
    • Mycoplasma Detection Plus Kit (PCR)
    • Mycoplasma Detection Kit (qPCR)
    • Gram Stain Kit
    • Endotoxin Detection Kit (Recombinant Factor C)
    • Pyrogen-Free Water
    • Hematoxylin-Eosin Staining Kit
    • Hematoxylin-Eosin Staining Kit (Including Differentiation and Bluing Solutions)
    • Alcian Blue Staining Solution (pH 2.5)
    • Alcian Blue Staining Solution (pH 1.0)
    • Periodic Acid-Schiff (PAS) Staining Kit
    • AB—PAS Staining Kit
    • Methenamine Silver Stain Kit For Basement Membrane (PASM)
    • Modified Safranin O–Fast Green Cartilage Staining Kit
    • Masson Staining Kit
    • Modified Masson Staining Kit
    • Sirius Red Staining Kit
    • Modified Van Gieson Staining Kit
    • Weigert Elastin Staining Kit
    • Oil Red O Staining Kit for Cultured Cells
    • Oil Red O Staining Kit for Cell Smears
    • ATPase Staining Kit for Muscle Fibers (Calcium Activation Method)
    • Giemsa Staining Solution (Chromosome G-Banding)
    • Wright-Giemsa Stain Kit
    • DAB Peroxidase Substrate Kit (Brown)
    • DAB Peroxidase Substrate Kit (Purple-Blue Color)
    • Basement Membrane Matrix (Phenol Red)
    • Basement Membrane Matrix
    • Basement Membrane Matrix GFR (Phenol Red)
    • Basement Membrane Matrix GFR
    • Basement Membrane Matrix HC (Phenol Red)
    • Basement Membrane Matrix IPSC-qualified
    • Basement Membrane Matrix for Organoid Culture
    • Basement Membrane Matrix HC
    • Basement Membrane Matrix GFR&HC
    • Stem Cell Basement Membrane Matrix (Ready-to-Use)
    • Cell Invasion Basement Membrane Matrix (Ready-to-Use)
    • In Vitro Angiogenesis Basement Membrane Matrix (Ready-to-Use)
    • Human Breast Cancer Organoid Kit
    • Human Breast Cancer Organoid Complete Culture Medium
    • Human Lung Adenocarcinoma Organoid Kit
    • Human Small Cell Lung Cancer Organoid Kit
    • Human Colorectal Cancer Organoid Kit
    • Human Colorectal Cancer Organoid Complete Culture Medium
    • Human Gastric Cancer Organoid Kit
    • Human Gastric Cancer Organoid Complete Culture Medium
    • Human Cholangiocarcinoma Organoid Kit
    • Human Cervical Cancer Organoid Kit
    • Human Esophageal Cancer Organoid Kit
    • Human Endometrial Cancer Organoid Kit
    • Human Pancreatic Cancer Organoid Kit
    • Human Lung Squamous Cell Carcinoma Organoid Kit
    • Human Bladder Cancer Organoid Kit
    • Human Ovarian Cancer Organoid Kit
    • Human Ovarian Cancer Organoid Complete Culture Medium
    • Human Hepatocellular Carcinoma Organoid Kit
    • Human Neuroendocrine Neoplasm Organoid Kit
    • Human Kidney Cancer Organoid Kit
    • Human Oral Squamous Carcinoma Organoid Kit
    • Human Salivary Gland Cancer Organoid Kit
    • Human Nasopharyngeal Carcinoma Organoid Kit
    • Brain Glioma Organoid Kit
    • Rhabdomyosarcoma Organoid Kit
    • Neuroblastoma Organoid Kit
    • Hepatoblastoma Organoid Kit
    • Human Colonic Organoid Kit
    • Human Intestinal Organoid Kit
    • Human Gastric Epithelial Organoid Kit
    • Human Pancreatic Organoid Kit
    • Human Kidney Tubular Organoid Kit
    • Human Liver Ductal Organoid (expansion) Kit
    • Mouse Liver Ductal Organoid (expansion) Kit
    • Mouse Intestinal Organoid Kit
    • Mouse Intestinal Organoid Plus Kit
    • Mouse Colonic Organoid Kit
    • Human Airway Organoid Kit
    • Human Endometrium Organoid Kit
    • Human Esophageal Organoid Kit
    • Human Mammary Epithelial Organoid Kit
    • Mouse Liver Ductal (Differentiation) Organoid Kit
    • Mouse Airway Organoid Kit
    • Human Liver Ductal (Differentiation) Organoid Kit
    • Human Brain Organoid (Expansion) Kit
    • Human Brain (Differentiation) Organoid Kit
    • Mouse Fetal Brain Organoid (Expansion) Kit
    • Mouse Fetal Brain (Differentiation) Organoid Kit
    • Tissue Storage Solution
    • Tumor Tissue Dissociation Solution
    • Tissue Dissociation Solution
    • Organoid Dissociation Solution
    • Organoid Cryopreservation Medium (Serum Free)
    • Organoid Recovery Solution
    • Organoid Vitality Assay Kit
    • 3D Cell-ATP Viability Detection Kit
    • Organoid Anti-Adhesion Rinsing Solution
    • CEPT Cocktail Plus (1000×)
    • ECM Gentle Dissociation Solution
    • Cardiomyocyte Dissociation Solution
    • Human iPSC/ESC Cortical Brain Organoid Induction Differentiation Kit
    • Human iPSC/ESC Whole-Brain Organoid Induction Differentiation Kit
    • Human iPSC/ESC Cardiomyocyte Induction Differentiation Kit
    • Human iPSC/ESC Hepatocyte Induction Differentiation Kit
    • Human PSC Islet Organoid Differentiation Kit
    • Human PSC Maintenance Medium
    • Human iPSC-Derived Brain Organoid Long-term Culture Medium
    • Human PSC Embryoid Body (EB) Induction Medium
    • Human iPSC/ESC Cortical Brain Organoid Maturation Medium
    Molecular Biology
    • Nucleic Acid Gel Electrophoresis
    • Vector Construction
    • Restriction Endonuclease
    • Materials
    • PCR & qPCR
    • RT-PCR
    • Sequencing
    Protein Biology
    • Protein Sample Preparation
    • Protein Purification
    • Protein Electrophoresis & WB
    • Multiple Fluorescent Staining
    • Immunoassay
    • Immunoprecipitation Kit
    • Labeling Kit
    Cell Biology
    • Cell Culture
    • Cell Analysis
    • 3D Cell Culture
    • Cell Isolation
    Biological Laboratory Consumables
    • Sample Storage
    More...
    • Nucleic Acid Gel Electrophoresis
      • Nucleic Acid Gel Stain
      • Agarose
      • Loading & Running Buffer
      • DNA Marker
    • Vector Construction
      • Seamless Cloning
      • Ligase
      • Endonuclease
    • PCR & qPCR
      • Polymerase Chain Reaction (PCR)
      • Real-Time PCR
      • DNA Polymerase
      • Direct PCR
    • RT-PCR
      • Reverse transcription PCR
      • RNase Inhibitor
    • Sequencing
      • Enzymes
    • Protein Sample Preparation
      • Cell Lysis
      • Washing Buffer
      • Protease Inhibitor Cocktail
      • Phosphatase Inhibitor Cocktail
      • Deacetylase Inhibitor Cocktail
      • Kinase Inhibitor Cocktail
      • Protein Assay
    • Protein Purification
      • Magnetic Stand
      • Magnetic Beads
      • Affinity Chromatography Column
      • Agarose Beads
      • Equilibration Buffer
      • Magnetic Agarose Beads
    • Protein Electrophoresis & WB
      • Electrophoresis Buffer
      • Protein Marker
      • Transfer Buffer
      • Blocking Buffer
      • Binding/Washing Buffer
      • Chemiluminescent Detection
      • Loading Buffer
      • Protein Staining Solution
      • Gel Preparation Kit
      • Antibody Dilution Buffer
      • Protein Gel
    • Cell Culture
      • Cell Transfection
      • Mycoplasma Clearance
      • Sterile Antibiotic Solution
      • Cell Freezing
      • CEPT cocktail
      • Basal Cell Culture Media
      • Balanced Salt Solutions
      • Cell Culture Supplements
      • Dissociation Reagents
      • Cell Separation Media
      • Specialized Cell Culture Medium
      • Lentivirus
    • Cell Analysis
      • Cell Proliferation and Cytotoxicity
      • Reporter Gene Testing
      • Phalloidin Dye Conjugates
      • Cell Apoptosis and Necrosis
      • AntiFade Mounting Medium
      • Mitochondrial Isolation
      • Exosome Isolation, Purification and Detection
      • Organelle Research
      • Metabolism Assay Kit
      • Mycoplasma Detection
      • Biochemical Assay Kit
      • Endotoxin Detection
      • Staining Kit
    • 3D Cell Culture
      • Basement Membrane Matrix
      • Tumor Organoid Culture Medium
      • Normal Tissue Organoid Culture Medium
      • Organoid Research
      • PSC Induction Product Series
    • More...
    • Scientific Reviews
    • Topics
    • Product Guides
    • Blogs
    • Protocols
    • Brochures
    • Promotions
    • Events and Webinars
    • Genes
    • Mapping Cancer Vulnerabilities: The Expanding Landscape of Synthetic Lethality
      2026-10-01
    • Metabolic Regulation of Ferroptosis: Iron, Lipids and Polyamines
      2026-09-24
    • Immunocytochemistry and Immunofluorescence Step by Step Guide
      2026-09-20
    • View More
    • Target-related Cytokines
      Target-related Cytokines
      2026-09-23
    • Microglial Replacement Therapy and Translation of Central Nervous System Disease Treatments
      Microglial Replacement Therapy and Translation of Central Nervous System Disease Treatments
      2026-09-22
    • VD/VDR Signaling and Programmed Cell Death in Brain Injury
      VD/VDR Signaling and Programmed Cell Death in Brain Injury
      2026-09-22
    • View More
    • Scientific Reviews
    • Topics
    • Product Guides
    • Blogs
    • Protocols
    • Brochures
    • Promotions
    • Events and Webinars
    • Custom Synthesis Services
    • Antibody Customization Services
    • One-stop Compound Screening Platform
    • Analytical Testing Services
    • One-stop CDMO Services
    • Quality Management System
    • Calculator Application
    • Bulk and Custom Synthesis Services
    • ADC-Related Custom Services
    • PROTAC-Related Custom Services
    • Custom Reference Standard Products
    • Custom Peptide Synthesis
    • AI-Powered Peptide Design Service
    • Recombinant Protein Expression Services
    • Recombinant Antibody Expression Services
    • Protein Crystal Structure Elucidation
    • Oligonucleotide Synthesis
    • Lipid Nanoparticles (LNP) Encapsulation Service
    • Fluorescent Labeling Services
    • Custom Synthesis of Stable Isotope-Labeled Compounds
    • More...
    • Rabbit Polyclonal Antibody Custom Services
    • Rabbit Monoclonal Antibody Custom Services
    • Mouse Monoclonal Antibody Custom Services
    • More...
    • One-Stop Drug Screening Platform
    • Virtual Screening
    • AI Driven Drug Screening
    • Molecular Docking
    • Molecular Dynamics Simulation
    • Surface Plasmon Resonance (SPR) Assay Services
    • Molecular Interaction Assay Services
    • DEL Synthesis and Screening
    • mRNA Display Technology
    • Affinity Mass Spectrometry
    • SPRi High Throughput Screening
    • Cell-based Compound Screening
    • High-Content Screening
    • GPCR Bioassay Screening Services
    • Kinase Screening Services
    • Ion Channel Screening
    • Nuclear Receptor Screening Services
    • Drug Target Identification Services
    • Lead Optimization
    • More...
    • Biological Macromolecule Drug Testing Services
    • Small Molecule Chemical Drug Testing Services
    • More...
        • Molarity Calculator
        • Dilution Calculator
        • Density Calculator
        • Reconstitution Calculator
        • Specific Activity Calculator
        • Protein Sequence Alignment Tool
        • Protein pI, MW and Extinction Coefficient Calculator
        • DNA Sequence Alignment Tool
        • DNA/RNA Sequence Conversion Tool
        • DNA Molecular Weight Calculator
        • More...
        • Custom Synthesis Services
          • Bulk and Custom Synthesis Services
          • ADC-Related Custom Services
          • PROTAC-Related Custom Services
          • Custom Reference Standard Products
          • Custom Peptide Synthesis
          • AI-Powered Peptide Design Service
          • Recombinant Protein Expression Services
          • Recombinant Antibody Expression Services
          • Protein Crystal Structure Elucidation
          • Oligonucleotide Synthesis
          • Lipid Nanoparticles (LNP) Encapsulation Service
          • Fluorescent Labeling Services
          • Custom Synthesis of Stable Isotope-Labeled Compounds
        • Antibody Customization Services
          • Rabbit Polyclonal Antibody Custom Services
          • Rabbit Monoclonal Antibody Custom Services
          • Mouse Monoclonal Antibody Custom Services
        • One-stop Compound Screening Platform
          • Virtual Screening
          • Molecular Dynamics Simulation
          • Cell-based Compound Screening
          • High-Content Screening
          • Ion Channel Screening
          • Kinase Screening Services
          • Surface Plasmon Resonance (SPR) Assay Services
          • GPCR Bioassay Screening Services
          • Nuclear Receptor Screening Services
          • Affinity Mass Spectrometry
          • DEL Synthesis and Screening
          • mRNA Display Technology
          • SPRi High Throughput Screening
          • Molecular Interaction Assay Services
          • Drug Target Identification Services
          • AI Driven Drug Screening
          • Computer-aided Reverse Target Identification
          • Network Pharmacology / Network Toxicology Analysis
        • Analytical Testing Services
          • Biological Macromolecule Drug Testing Services
          • Small Molecule Chemical Drug Testing Services
        • One-stop CDMO Services
        • Quality Management System
        • Calculator Application
          • Molarity Calculator
          • Dilution Calculator
          • Density Calculator
          • Reconstitution Calculator
          • Specific Activity Calculator
          • Protein Sequence Alignment Tool
          • Protein pI, MW and Extinction Coefficient Calculator
          • DNA Sequence Alignment Tool
          • DNA/RNA Sequence Conversion Tool
          • DNA Molecular Weight Calculator
        Delivery of temperature sensitive items including proteins and kits will be paused on 6/19 for the Juneteenth holiday. For urgent orders please contact customer service.
        • Signaling Pathways
        • Membrane Transporter/Ion ChannelNeuronal Signaling
        • iGluR
        • iGluR Isoform

        iGluR

        All Product Categories

        • iGluR Inhibitors (83)

          View all products

        • iGluR Agonists (52)

          View all products

        • iGluR Antagonists (192)

          View all products

        • iGluR Activators (15)

          View all products

        • iGluR Modulators (57)

          View all products

        • iGluR Controls (4)

          View all products

        • iGluR Ligand (1)

          View all products

        • iGluR Related Products (456)

          Related Products (456)

        By Effects:
        Loading...
        Show More (7)
        iGluR Related Products
        Related Products
        • By Effects 0
        Clear Filters
        • 1
        • 2
        • ...
        • 21
        • 22
        • 23
        • (Rac)-NMDAR antagonist 1 (Standard)
          (Rac)-NMDAR antagonist 1 (Standard)
          0 Images
          Cat. No.: HY-111500R
          CAS No.: 2435557-99-4
          (Rac)-NMDAR antagonist 1 (Standard) is the analytical standard of (Rac)-NMDAR antagonist 1 (HY-111500). This product is intended for research and analytical applications. (Rac)-NMDAR antagonist 1 is the racemate of NMDAR antagonist 1. NMDAR antagonist 1 is a potent and orally bioavailable NR2B-selective NMDAR antagonist.
        • loading...
          Please select quantity
          Get Quote

          August 31

            loading...
          • Please select quantity

            August 31

            Get Quote
          View All Sizes
        • GNE-8324 (Standard)
          GNE-8324 (Standard)
          0 Images
          Cat. No.: HY-107498R
          CAS No.: 1698901-76-6
          GNE-8324 (Standard) is the analytical standard of GNE-8324 (HY-107498). This product is intended for research and analytical applications. GNE-8324 is a selective GluN2A positive allosteric modulator. GNE-8324 selectively enhances NMDA receptor (NMDAR)-mediated synaptic responses in inhibitory but not excitatory neurons.
        • loading...
          Please select quantity
          Get Quote

          August 31

            loading...
          • Please select quantity

            August 31

            Get Quote
          View All Sizes
        • UBP608 (Standard)
          UBP608 (Standard)
          0 Images
          Cat. No.: HY-100667R
          CAS No.: 2199-87-3
          UBP608 (Standard) is the analytical standard of UBP608 (HY-100667). This product is intended for research and analytical applications. UBP608 is a potent N-Methyl-D-aspartate receptors (NMDARs) negative allosteric modulator. UBP608 has the potential for the research of neurological disorders.
        • loading...
          Please select quantity
          Get Quote

          August 31

            loading...
          • Please select quantity

            August 31

            Get Quote
          View All Sizes
        • LY-503430
          LY-503430
          0 Images
          Cat. No.: HY-122164
          CAS No.: 625820-83-9
          LY-503430 is an orally active AMPA receptor positive allosteric modulator (PAM). LY-503430 can be used for the study of Parkinson's disease.
        • loading...
          Please select quantity
          Get Quote

          August 31

            loading...
          • Please select quantity

            August 31

            Get Quote
          View All Sizes
        • Isoxsuprine
          Isoxsuprine
          0 Images
          Cat. No.: HY-B1270A
          CAS No.: 395-28-8
          Isoxsuprine is a beta-adrenergic receptor agonist with Kis of 13.65 μΜ and 3.48 μΜ for myometrial and placcntal beta-adrenergic receptor, respectively. Isoxsuprine hydrochloride is also a NMDA receptor antagonist.
        • loading...
          Please select quantity
          Get Quote

          August 31

            loading...
          • Please select quantity

            August 31

            Get Quote
          View All Sizes
        • Orphenadrine citrate (Standard)
          Orphenadrine citrate (Standard)
          0 Images
          Cat. No.: HY-B0369AR
          CAS No.: 4682-36-4
          Purity: 98%
          Orphenadrine (citrate) (Standard) is the analytical standard of Orphenadrine (citrate). This product is intended for research and analytical applications. Orphenadrine citrate is an orally active and non-competitive NMDA receptor antagonist (crosses the blood-brain barrier) with a Ki of 6.0 μM. Orphenadrine citrate relieves stiffness, pain and discomfort due to muscle strains, sprains or other injuries. Orphenadrine citrate is also used to relieve tremors associated with parkinson's disease. Orphenadrine citrate has good neuroprotective properties, can be used in studies of neurodegenerative diseases.
        • loading...
          Please select quantity
          Get Quote

          August 31

            loading...
          • Please select quantity

            August 31

            Get Quote
          View All Sizes
        • Pep1-AGL
          Pep1-AGL
          0 Images
          Cat. No.: HY-P1364
          Pep1-AGL is a peptide with the sequence of SSGMPLGAAGL. Pep1-AGL serves as the control peptide for Pep1-TGL (HY-P1367).
        • loading...
          Please select quantity
          Get Quote

          August 31

            loading...
          • Please select quantity

            August 31

            Get Quote
          View All Sizes
        • TAT-GluR6-9c
          TAT-GluR6-9c
          0 Images
          Cat. No.: HY-P10401
          TAT-GluR6-9c is a GluR6-PSD95 interaction blocker. By regulating the GluR6 mediated signaling pathway, TAT-GluR6-9c inhibits the activation of JNK and phosphorylation of c-Jun, reduces the expression of Fas L and thus reduces the occurrence of apoptosis. TAT-GluR6-9c can be used to study cerebral ischemia and neuroprotective strategies .
        • loading...
          Please select quantity
          Get Quote

          August 31

            loading...
          • Please select quantity

            August 31

            Get Quote
          View All Sizes
        • Dasolampanel
          Dasolampanel
          0 Images
          Cat. No.: HY-19465
          CAS No.: 503294-13-1
          Dasolampanel is a kainate receptor antagonist that helps regulate the excitability of the nervous system by blocking kainate receptors and reducing glutamate-mediated excitatory transmission. Dasolampanel can be used in the study of diseases such as overexcitement and sleep disorders.
        • loading...
          Please select quantity
          Get Quote

          August 31

            loading...
          • Please select quantity

            August 31

            Get Quote
          View All Sizes
        • Eliprodil (Standard)
          Eliprodil (Standard)
          0 Images
          Cat. No.: HY-12881R
          CAS No.: 119431-25-3
          Purity: 98%
          Synonyms: SL-820715 (Standard)
          Eliprodil (Standard) is the analytical standard of Eliprodil. This product is intended for research and analytical applications. 0
        • loading...
          Please select quantity
          Get Quote

          August 31

            loading...
          • Please select quantity

            August 31

            Get Quote
          View All Sizes
        • Ifenprodil tartrate (Standard)
          Ifenprodil tartrate (Standard)
          0 Images
          Cat. No.: HY-12882AR
          CAS No.: 23210-58-4
          Purity: 98%
          Synonyms: NP-120 tartrate (Standard); RC-61-91 tartrate (Standard)
          Ifenprodil (tartrate) (Standard) is the analytical standard of Ifenprodil (tartrate). This product is intended for research and analytical applications. Ifenprodil tartrate is a typical noncompetitive NMDA receptor antagonist. Ifenprodil tartrate exerts high affinity at NR1A/NR2B receptors (IC50=0.34 μM) over 400-fold than at NR1A/NR2A receptors (IC50=146 μM). Ifenprodil tartrate inhibits GIRK (Kir3), reduces inward currents through the basal GIRK activity. Ifenprodil tartrate has the potential to be a cerebral vasodilator.
        • loading...
          Please select quantity
          Get Quote

          August 31

            loading...
          • Please select quantity

            August 31

            Get Quote
          View All Sizes
        • IC87201 (Standard)
          IC87201 (Standard)
          0 Images
          Cat. No.: HY-100457R
          CAS No.: 866927-10-8
          IC87201 (Standard) is the analytical standard of IC87201 (HY-100457). This product is intended for research and analytical applications. IC87201, an inhibitor of PSD95-nNOS protein-protein interactions, suppresses NMDAR-dependent NO and cGMP formation.
        • loading...
          Please select quantity
          Get Quote

          August 31

            loading...
          • Please select quantity

            August 31

            Get Quote
          View All Sizes
        • UBP296
          UBP296
          0 Images
          Cat. No.: HY-107605
          CAS No.: 745055-86-1
          UBP296 is a potent and selective antagonist of GLUK5-containing kainate receptor in the spinal cord. UBP296 reversibly blocks ATPA-induced depressions of synaptic transmission, and affects AMPA receptor-mediated synaptic transmission directly in rat hippocampal slices.
        • loading...
          Please select quantity
          Get Quote

          August 31

            loading...
          • Please select quantity

            August 31

            Get Quote
          View All Sizes
        • VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
          VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
          0 Images
          Cat. No.: HY-P3431
          CAS No.: 2279952-25-7
          VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain.
        • loading...
          Please select quantity
          Get Quote

          August 31

            loading...
          • Please select quantity

            August 31

            Get Quote
          View All Sizes
        • 15-Methoxypinusolidic acid
          15-Methoxypinusolidic acid
          0 Images
          Cat. No.: HY-N1593
          CAS No.: 769928-72-5
          15-Methoxypinusolidic acid (compound 1) is a labdane diterpene compound isolated from the leaves of Calocedrus microlepic.
        • loading...
          Please select quantity
          Get Quote

          August 31

            loading...
          • Please select quantity

            August 31

            Get Quote
          View All Sizes
        • VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA
          VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA
          0 Images
          Cat. No.: HY-P3431A
          VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain.
        • loading...
          Please select quantity
          Get Quote

          August 31

            loading...
          • Please select quantity

            August 31

            Get Quote
          View All Sizes
        • 1
        • 2
        • ...
        • 21
        • 22
        • 23
        Assay Types
        Product Comparison
        Clear All
        Compare
        PD-L1 Protein, Human (HEK293, His)PD-L1 Protein, Human
        Product Comparison
        Products
        /
        In-stock
        -
        +
        Please select quantity

        Expand

        Add to Cart
        Cat. No.
        Purity
        Feature
        CAS No.
        Storage
        Solvent & Solubility
        Appearance
        Initial Source
        Emission (Em)
        Excitation (Ex)
        Sequence Shortening
        Isotype
        Gene ID
        Accession
        Application
        Reconsititution
        Molecular Weight molecularWeight
        Enzyme Activity
        Specific Activity
        In Vitro
        In Vivo
        Size
        • /
          In-stock
          -
          +
          Add to Cart
          Bulk Inquiry
          Please select quantity
        Product Comparison
        Products
        /
        In-stock
        -
        +
        Please select quantity

        Expand

        Add to Cart
        Cat. No.
        Species
        Source source
        Tag tag
        Accession accession
        Gene ID geneId
        Molecular Weight molecularWeight
        Purity purity
        Endotoxin Level
        Biological Activity
        Appearance
        Formulation
        Storage & Stability
        Shipping
        Size

        * 该产品已 “停产”.

        等效替代:

        • /
          In-stock
          -
          +
          Add to Cart
          Bulk Inquiry
          Please select quantity
        Product Comparison
        Products
        /
        In-stock
        -
        +
        Please select quantity

        Expand

        Add to Cart
        Cat. No.
        Host
        Reactivity
        Application
        Dilution
        Ratio
        Molecular Weight
        Conjugation
        Clonality
        Immunogen
        Appearance
        Isotype
        Gene ID
        SwissProt ID
        Purity
        Formulation
        Size

        * 该产品已 “停产”.

        等效替代:

        • /
          In-stock
          -
          +
          Add to Cart
          Bulk Inquiry
          Please select quantity
        Inquiry Online

        Your information is safe with us. *Required Fields.

        Field is required.
        Field is required.
        Field is required.
        Field is required.
        Field is required.
        Please enter a valid Email Address.
        Field is required.
        Field is required.
        Field is required.
        Field is required.
        Field is required.
        Field is required.
        Field is required.

        MCE Japan Authorized Agent:

        Bulk Inquiry Request for Report Inquiry Online Customer Review Request for Recombinant Proteins Catalog
        We have received your request and will respond to you as soon as possible. Congratulations! Uh-oh!

        We have received your inquiry regarding and will respond to you as soon as possible. We have received your request and will respond to you as soon as possible. Thank You for Your Feedback! This product is a controlled substance and not for sale in your territory. It appears that we were unable to send an email to . Please verify your email address and try again!

        Inquiry Information
        Product Name:
        Cat. No.:
        Quantity:
        MCE Japan Authorized Agent:
        Inquiry Information
        Product Name:
        CAS No.:
        Species:
        Purity:
        Quantity:
        MedChemExpress
        MedChemExpress
        • Contact Us
        • About Us
        • Headquarters
        • Distributors
        • Statement on False Report
        • Careers
        Customer Support
        Customer Support
        • Technical Support
        • Services
        • Ordering Information
        • Easy Return
        • Shipping Rates & Policies
        • Terms & Conditions
        • Intellectual Property Promise
        Resources
        Resources
        • Free Sample
        • Calculator Application
        • Scientific Reviews
        • Topics
        • Product Guides
        • Blogs
        • Protocols
        • Brochures
        • Promotions
        • Events and Webinars
        • Genes
        • Biomedical Dictionary
        Subscribe to our E-newsletter
        Sorry, but the email address you supplied was invalid.
        Thanks, your subscription has been confirmed. You will hear from us soon.
        Submission failed, please try again later.

        Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.

        Copyright © 2013-2026 MedChemExpress.  All Rights Reserved.

        Site Map | Privacy and Cookie Policy

        Twitter Facebook Linkedin Instagram
        Online Service Online Customer Service
        Contact Us
        Happy to help!
        MedChemExpress MedChemExpress
        Tel: 609-228-6898
        E-mail: [email protected]
        Technical Support: [email protected]
        MedChemExpress

        We use cookies

        MedChemExpress values your privacy and your trust is important to us. We use cookies to enhance your website experience. Some cookies are necessary to run the website. Privacy and Cookie Policy