iGluR
-
iGluR Related Products (456)
Related Products (456)
-
(Rac)-NMDAR antagonist 1 (Standard)
0 ImagesCat. No.: HY-111500RCAS No.: 2435557-99-4(Rac)-NMDAR antagonist 1 (Standard) is the analytical standard of (Rac)-NMDAR antagonist 1 (HY-111500). This product is intended for research and analytical applications. (Rac)-NMDAR antagonist 1 is the racemate of NMDAR antagonist 1. NMDAR antagonist 1 is a potent and orally bioavailable NR2B-selective NMDAR antagonist.
-
GNE-8324 (Standard)
0 ImagesCat. No.: HY-107498RCAS No.: 1698901-76-6GNE-8324 (Standard) is the analytical standard of GNE-8324 (HY-107498). This product is intended for research and analytical applications. GNE-8324 is a selective GluN2A positive allosteric modulator. GNE-8324 selectively enhances NMDA receptor (NMDAR)-mediated synaptic responses in inhibitory but not excitatory neurons.
-
UBP608 (Standard)
0 ImagesCat. No.: HY-100667RCAS No.: 2199-87-3
-
LY-503430
0 ImagesCat. No.: HY-122164CAS No.: 625820-83-9LY-503430 is an orally active AMPA receptor positive allosteric modulator (PAM). LY-503430 can be used for the study of Parkinson's disease.
-
Isoxsuprine
0 ImagesIsoxsuprine is a beta-adrenergic receptor agonist with Kis of 13.65 μΜ and 3.48 μΜ for myometrial and placcntal beta-adrenergic receptor, respectively. Isoxsuprine hydrochloride is also a NMDA receptor antagonist.
-
Orphenadrine citrate (Standard)
0 ImagesOrphenadrine (citrate) (Standard) is the analytical standard of Orphenadrine (citrate). This product is intended for research and analytical applications. Orphenadrine citrate is an orally active and non-competitive NMDA receptor antagonist (crosses the blood-brain barrier) with a Ki of 6.0 μM. Orphenadrine citrate relieves stiffness, pain and discomfort due to muscle strains, sprains or other injuries. Orphenadrine citrate is also used to relieve tremors associated with parkinson's disease. Orphenadrine citrate has good neuroprotective properties, can be used in studies of neurodegenerative diseases.
-
TAT-GluR6-9c
0 ImagesCat. No.: HY-P10401TAT-GluR6-9c is a GluR6-PSD95 interaction blocker. By regulating the GluR6 mediated signaling pathway, TAT-GluR6-9c inhibits the activation of JNK and phosphorylation of c-Jun, reduces the expression of Fas L and thus reduces the occurrence of apoptosis. TAT-GluR6-9c can be used to study cerebral ischemia and neuroprotective strategies .
-
Dasolampanel
0 ImagesCat. No.: HY-19465CAS No.: 503294-13-1Dasolampanel is a kainate receptor antagonist that helps regulate the excitability of the nervous system by blocking kainate receptors and reducing glutamate-mediated excitatory transmission. Dasolampanel can be used in the study of diseases such as overexcitement and sleep disorders.
-
Eliprodil (Standard)
0 ImagesSynonyms: SL-820715 (Standard)Eliprodil (Standard) is the analytical standard of Eliprodil. This product is intended for research and analytical applications. 0
-
Ifenprodil tartrate (Standard)
0 ImagesSynonyms: NP-120 tartrate (Standard); RC-61-91 tartrate (Standard)Ifenprodil (tartrate) (Standard) is the analytical standard of Ifenprodil (tartrate). This product is intended for research and analytical applications. Ifenprodil tartrate is a typical noncompetitive NMDA receptor antagonist. Ifenprodil tartrate exerts high affinity at NR1A/NR2B receptors (IC50=0.34 μM) over 400-fold than at NR1A/NR2A receptors (IC50=146 μM). Ifenprodil tartrate inhibits GIRK (Kir3), reduces inward currents through the basal GIRK activity. Ifenprodil tartrate has the potential to be a cerebral vasodilator.
-
IC87201 (Standard)
0 ImagesCat. No.: HY-100457RCAS No.: 866927-10-8
-
UBP296
0 ImagesCat. No.: HY-107605CAS No.: 745055-86-1UBP296 is a potent and selective antagonist of GLUK5-containing kainate receptor in the spinal cord. UBP296 reversibly blocks ATPA-induced depressions of synaptic transmission, and affects AMPA receptor-mediated synaptic transmission directly in rat hippocampal slices.
-
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
0 ImagesCat. No.: HY-P3431CAS No.: 2279952-25-7VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain.
-
15-Methoxypinusolidic acid
0 ImagesCat. No.: HY-N1593CAS No.: 769928-72-515-Methoxypinusolidic acid (compound 1) is a labdane diterpene compound isolated from the leaves of Calocedrus microlepic.
-
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA
0 ImagesCat. No.: HY-P3431AVSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain.
