Adropin (34-76) (human, mouse, rat)
Based on 1 publication(s) in Google Scholar
Adropin (34-76) is a secretory domain of Adropin. Adropin (34-76) can inhibit cAMP level and glucose production in hepatocytes, and has a hypoglycemic effect. Adropin (34-76) plays an antifibrotic role by inhibiting the GLI1 signaling pathway.
For research use only. We do not sell to patients.
- Purity : 98.23%
- CAS No.: 1802086-30-1
- Formula: C190H293N55O68S2
- Molecular Weight:4499.82
-
Storage:
Sealed storage, away from moisture and light.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Publications Citing Use of MedChemExpress (MCE) Adropin (34-76) (human, mouse, rat)
More
Biological Activity
Description
In Vitro
Adropin (34-76) (100 nM; 3 h) inhibits glucose production in primary cultured mouse hepatocytes[1].
Adropin (34-76) (100 nM; 3 h) decreases cAMP levels in HepG2 hepatocytes[1].
Adropin (34-76) (0-100 ng/mL; 48 h) inhibits TGF-β-induced cell activation, collagen production and fibrotic remodeling in fibroblasts[2].
Adropin (34-76) (100 ng/mL; 48 h) plays an anti-fibrotic role in fibroblasts by inhibiting the GLI1 signaling pathway[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. .
-
Cell Line:TGF-β treated fibroblasts
-
Concentration:0, 10, 50 and 100 ng/mL
-
Incubation Time:48 h
-
Result:Reduced the levels of α-smooth muscle actin and type І collagen in a dose-dependent manner.
-
Cell Line:TGF-β treated fibroblasts
-
Concentration:100 ng/mL
-
Incubation Time:48 h
-
Result:Reduced GLI1 and GLI2 staining intensity but did not interfere with the nuclear translocation of GLI1 or GLI2.
In Vivo
Adropin (34-76) (10 μg/kg/h; subcutaneous osmotic pump; 25 days) has an improved effect in the mouse model of fibrosis[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Male DIO B6 mice[1]
-
Dosage:450 nmol/kg ≈ 2 mg/kg
-
Administration:Five intraperitoneal injections over a 48-h period
-
Result:Enhanced intracellular signaling actions underlying insulin’s effect on hepatic glucose metabolism.
Alleviated hepatic ER stress responses.
Diminished JNK and PKA signaling in the liver.
Down-regulates hepatic lipogenic genes.
Altered the phosphorylation levels of IP3R in the liver.
-
Animal Model:Mouse with fibrosis model[2]
-
Dosage:10 μg/kg/h
-
Administration:Subcutaneous osmotic pump; 25 days
-
Result:Ameliorated allogeneic bone marrow transplantation (alloBMT)-induced skin fibrosis, with reduced dermal thickness, lower myofibroblast counts, and decreased hydroxyproline content.
Ameliorated alloBMT-induced pulmonary fibrosis, with reduced Ashcroft scores and hydroxyproline content.
Chemical Information
-
CAS No. 1802086-30-1
-
Appearance Solid
-
Molecular Weight 4499.82
-
Formula C190H293N55O68S2
-
Color White to off-white
-
Sequence
Cys-His-Ser-Arg-Ser-Ala-Asp-Val-Asp-Ser-Leu-Ser-Glu-Ser-Ser-Pro-Asn-Ser-Ser-Pro-Gly-Pro-Cys-Pro-Glu-Lys-Ala-Pro-Pro-Pro-Gln-Lys-Pro-Ser-His-Glu-Gly-Ser-Tyr-Leu-Leu-Gln-Pro (Disulfide bridge: Cys1-Cys23)
-
Sequence Shortening
CHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP (Disulfide bridge: Cys1-Cys23)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture and light
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Metab Brain Dis
Adropin ameliorates behavioral seizures and the relevant neuroinflammation, oxidative stress, and neural damage in a rat model of pentylenetetrazole-induced seizure potentially by reducing the activation of NF-κB/IkB-α signaling pathway. [Abstract]2025 Jun 13;40(5):222. PMID: 40512435
Solvent & Solubility
In Vitro:
DMSO : ≥ 100 mg/mL (22.22 mM; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
* "≥" means soluble, but saturation unknown.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
In Vivo:
Select the appropriate dissolution method based on your experimental animal and administration route.
- For the following dissolution methods, please ensure to first prepare a clear stock solution using an In Vitro approach and then sequentially add co-solvents:
- To ensure reliable experimental results, the clarified stock solution can be appropriately stored based on storage conditions. As for the working solution for In Vivo experiments, it is recommended to prepare freshly and use it on the same day.
- The percentages shown for the solvents indicate their volumetric ratio in the final prepared solution. If precipitation or phase separation occurs during preparation, heat and/or sonication can be used to aid dissolution.
Add each solvent one by one: 10% DMSO 40% PEG300 5% Tween-80 45% Saline
Solubility: ≥ 2.5 mg/mL (0.56 mM); Clear solution
This protocol yields a clear solution of ≥ 2.5 mg/mL (saturation unknown).
Taking 1 mL working solution as an example, add 100 μL DMSO stock solution (25.0 mg/mL) to 400 μL PEG300, and mix evenly; then add 50 μL Tween-80 and mix evenly; then add 450 μL Saline to adjust the volume to 1 mL.
Preparation of Saline: Dissolve 0.9 g sodium chloride in ddH₂O and dilute to 100 mL to obtain a clear Saline solution.
Add each solvent one by one: 10% DMSO 90% (20% SBE-β-CD in Saline)
Solubility: ≥ 2.5 mg/mL (0.56 mM); Clear solution
This protocol yields a clear solution of ≥ 2.5 mg/mL (saturation unknown).
Taking 1 mL working solution as an example, add 100 μL DMSO stock solution (25.0 mg/mL) to 900 μL 20% SBE-β-CD in Saline, and mix evenly.
Preparation of 20% SBE-β-CD in Saline (4°C, storage for one week): 2 g SBE-β-CD powder is dissolved in 10 mL Saline, completely dissolve until clear.
In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:
-
-
-
-
Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Please enter your animal formula composition:
-
%DMSO +
Recommended: Keep the proportion of DMSO in working solution below 2% if your animal is weak.
-
%+
-
+%Tween-80 + +
-
%Saline +
The co-solvents required include: DMSO, . All of co-solvents are available by MedChemExpress (MCE). , Tween 80. All of co-solvents are available by MedChemExpress (MCE).
Working solution concentration: 0.22 mg/mL
Method for preparing stock solution: mg drug dissolved in μL DMSO. Stock solution concentration: mg/mL. * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
1. Take μL DMSO stock solution;
2. Add μL .
μL , mix evenly;
3. Then add μL Tween 80, mix evenly;
4. Then add μL
Please ensure that the stock solution in the first step is dissolved to a clear state, and add co-solvents in sequence. You can use ultrasonic heating (ultrasonic cleaner, recommended frequency 20-40 kHz), vortexing, etc. to assist dissolution.
Purity & Documentation
-
Data Sheet (300 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Gao S, et al. The peptide hormone adropin regulates signal transduction pathways controlling hepatic glucose metabolism in a mouse model of diet-induced obesity. J Biol Chem. 2019 Sep 6;294(36):13366-13377. [Content Brief]
[2]. Liang M, et al. Attenuation of fibroblast activation and fibrosis by adropin in systemic sclerosis. Sci Transl Med. 2024 Mar 27;16(740):eadd6570. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO | 1 mM | 0.2222 mL | 1.1112 mL | 2.2223 mL | 5.5558 mL |
| 5 mM | 0.0444 mL | 0.2222 mL | 0.4445 mL | 1.1112 mL | |
| 10 mM | 0.0222 mL | 0.1111 mL | 0.2222 mL | 0.5556 mL | |
| 15 mM | 0.0148 mL | 0.0741 mL | 0.1482 mL | 0.3704 mL | |
| 20 mM | 0.0111 mL | 0.0556 mL | 0.1111 mL | 0.2778 mL |