country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P10516

Copy Link Print Information

BRC4 peptide

BRC4 peptide is a specific peptide in BRCA2 protein that interacts with RAD51 protein to help repair broken DNA chains. BRC4 peptide can be used to study DNA repair mechanisms and cancer occurrence.

For research use only. We do not sell to patients.

Formula: C₁₇₈H₂₉₆N₄₈O₅₃
Molecular Weight:3956.54

Storage:

Please store the product under the recommended conditions in the Certificate of Analysis.

BRC4 peptide Chemical Structure

Size

Price

Stock

Quantity

Amount: USD 0.00

* Please select Quantity before adding items.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity

Description

All DNA/RNA Synthesis Isoforms :

Chemical Information

Molecular Weight 3956.54
Formula C₁₇₈H₂₉₆N₄₈O₅₃
Sequence

Lys-Glu-Pro-Thr-Leu-Leu-Gly-Phe-His-Thr-Ala-Ser-Gly-Lys-Lys-Val-Lys-Ile-Ala-Lys-Glu-Ser-Leu-Asp-Lys-Val-Lys-Asn-Leu-Phe-Asp-Glu-Lys-Glu-Gln-NH2
Sequence Shortening

KEPTLLGFHTASGKKVKIAKESLDKVKNLFDEKEQ-NH2
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (257 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. Gonzalez-Hormazabal P, et al. Spectrum of BRCA1/2 point mutations and genomic rearrangements in high-risk breast/ovarian cancer Chilean families[J]. Breast cancer research and treatment, 2011, 126: 705-716. [Content Brief]

Calculators

Molarity Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Dilution Calculator

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

100 mg

Get Quote In-stock