Kurtoxin
Kurtoxin is a selective Cav3 (T-type) voltage-gated Ca2+ channel gating inhibitor with a Kd of 15 nM for Cav3.1 (α1G T-type) Ca2+ channel. Kurtoxin can interact with high affinity with native neuronal high-threshold L-type, N-type, and P-type Ca2+ channels in central and peripheral neurons. Kurtoxin also shows cross-reactivity with voltage-gated Na+ channel.
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- Formule: C324H478N94O90S8
- Masse moléculaire:7386.36
-
Stockage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Activité biologique
-
Chemical Information
- Protocole
- Pureté et documentation
- Références
-
Help & FAQs
Voir tous les produits spécifiques à Isoform Calcium Channel
More
Activité biologique
Description
IC50 & Target
Kd: 15 nM (Cav3.1 (α1G T-type) Ca2+ channel)[1]
Chemical Information
-
Masse moléculaire 7386.36
-
Formule C324H478N94O90S8
-
Sequence
Lys-Ile-Asp-Gly-Tyr-Pro-Val-Asp-Tyr-Trp-Asn-Cys-Lys-Arg-Ile-Cys-Trp-Tyr-Asn-Asn-Lys-Tyr-Cys-Asn-Asp-Leu-Cys-Lys-Gly-Leu-Lys-Ala-Asp-Ser-Gly-Tyr-Cys-Trp-Gly-Trp-Thr-Leu-Ser-Cys-Tyr-Cys-Gln-Gly-Leu-Pro-Asp-Asn-Ala-Arg-Ile-Lys-Arg-Ser-Gly-Arg-Cys-Arg-Ala (Disulfide bridge: Cys12-Cys61,Cys16-Cys37,Cys23-Cys44,Cys27-Cys46)
-
Sequence Shortening
KIDGYPVDYWNCKRICWYNNKYCNDLCKGLKADSGYCWGWTLSCYCQGLPDNARIKRSGRCRA (Disulfide bridge: Cys12-Cys61,Cys16-Cys37,Cys23-Cys44,Cys27-Cys46)
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Please store the product under the recommended conditions in the Certificate of Analysis.
Protocole
-
Ca2+ Staining Technique
Ca2+ staining is an experimental technique that utilizes specific fluorescent probes (such as Fluo-4 AM, Fura-2, etc.) to qualitatively or quantitatively detect dynamic changes in intracellular Ca2+ concentrations; this is achieved by monitoring the changes in fluorescent signals generated when these probes bind to free intracellular calcium ions. The underlying principle relies primarily on the presence of chelating groups within the probe's molecular structure that possess high affinity for calcium ions.
Pureté et documentation
Références
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Kurtoxin Related Classifications
HY-P5869 Related Classifications
Powered by Bioz