GEP44
GEP44 is a peptide biased triple agonist targeting Glucagon-like peptide 1 receptor (GLP-1R), neuropeptide Y1 Receptor (Y1-R), and neuropeptide Y2 Receptor (Y2-R). GEP44 induces Y1-R antagonist-controlled, GLP-1R-dependent stimulation of insulin secretion in both rat and human pancreatic islets by counteracting effects of Y1-R and GLP-1R agonism. GEP44 promotes insulin-independent Y1-R-mediated glucose uptake in muscle tissue and significantly reduces food intake and body weight in diet-induced obese rat models. GEP44 can be used for obesity and type 2 diabetes mellitus research.
Para uso exclusivo en investigación. No vendemos a pacientes.
- Fòrmula: C233H356N68O68
- Peso molecular:5197.73
-
Almacenamiento:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Actividad biológica
-
Chemical Information
- Pureza y Documentación
- Referencias
-
Help & FAQs
Ver todos los productos específicos de isoformas Neuropeptide Y Receptor
MoreVer todos los productos específicos de isoformas Arrestin
More
Actividad biológica
|
NPY Y2 receptor 34 nM (IC50) |
NPY Y1 receptor 27 nM (IC50) |
Arrestin-3/β-Arrestin 2 |
Chemical Information
-
Peso molecular 5197.73
-
Fòrmula C233H356N68O68
-
Sequence
His-{d-Ser}-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Tyr-Leu-Glu-Glu-Glu-Ala-Val-Arg-Glu-Phe-Ile-Ala-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
-
Sequence Shortening
H-{d-Ser}-QGTFTSDLSKYLEEEAVREFIAWLKNGGPSRHYLNLVTRQRY-NH2
-
Envío
Room temperature in continental US; may vary elsewhere.
-
Almacenamiento
Please store the product under the recommended conditions in the Certificate of Analysis.
Pureza y Documentación
Referencias
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
GEP44 Related Classifications
HY-P11043 Related Classifications
Powered by Bioz