1. Membrane Transporter/Ion Channel
  2. Sodium Channel
  3. Mambalgin 1

Mambalgin 1 

Cat. No.: HY-P1441
Handling Instructions

Mambalgin 1 is a selective ASIC1a inhibitor (IC50 values are 192 and 72 nM for human ASIC1a and ASIC1a/1b dimer, respectively). Mambalgin 1 binds to closed/inactive channel. Mambalgin 1 is selective for ASIC1a over ASIC2a, ASIC3, TRPV1, P2X2, 5-HT3, Nav1.8, Cav3.2 and Kv1.2 channels. Mambalgin 1 increases latency of withdrawal response in mouse tail-flick and paw-flick tests.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Mambalgin 1 Chemical Structure

Mambalgin 1 Chemical Structure

CAS No. : 1609937-15-6

Size Stock
100 mg   Get quote  
250 mg   Get quote  
500 mg   Get quote  

* Please select Quantity before adding items.

Other Forms of Mambalgin 1:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • Customer Review

Description

Mambalgin 1 is a selective ASIC1a inhibitor (IC50 values are 192 and 72 nM for human ASIC1a and ASIC1a/1b dimer, respectively). Mambalgin 1 binds to closed/inactive channel. Mambalgin 1 is selective for ASIC1a over ASIC2a, ASIC3, TRPV1, P2X2, 5-HT3, Nav1.8, Cav3.2 and Kv1.2 channels. Mambalgin 1 increases latency of withdrawal response in mouse tail-flick and paw-flick tests.

Molecular Weight

7283.22

Formula

C₃₁₀H₄₈₁N₈₇O₁₀₀S₈

CAS No.

1609937-15-6

Sequence

Leu-Lys-Cys-Tyr-Gln-His-Gly-Lys-Val-Val-Thr-Cys-His-Arg-Asp-Met-Lys-Phe-Cys-Tyr-His-Asn-Thr-Gly-Met-Pro-Phe-Arg-Asn-Leu-Lys-Leu-Ile-Leu-Gln-Gly-Cys-Ser-Ser-Ser-Cys-Ser-Glu-Thr-Glu-Asn-Asn-Lys-Cys-Cys-Ser-Thr-Asp-Arg-Cys-Asn-Lys (Disulfide bridge:Cys3-Cys19;Cys12-Cys37;Cys41-Cys49;Cys50-Cys55)

Sequence Shortening

LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK (Disulfide bridge:Cys3-Cys19;Cys12-Cys37;Cys41-Cys49;Cys50-Cys55)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

Mambalgin 1Mambalgin1Mambalgin-1Sodium ChannelNa channelsNa+ channelsInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product name:
Mambalgin 1
Cat. No.:
HY-P1441
Quantity:
MCE Japan Authorized Agent: