GCGR
Glucagon Receptor
All Product Categories
-
GCGR Related Products (196)
Related Products (196)
-
Recombinant Proteins (15)
-
Antibodies (3)
- GRPP (human)
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
- HAEGTFTSDVS
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
ZP3022
0 ImagesZP3022 is a dual agonist of glucagon-like peptide-1 (GLP-1) and gastrin that has the ability to sustainably improve glycemic control. Additionally, ZP3022 can effectively increase β-cell mass, promote β-cell proliferation, and enhance the function of pancreatic islets. ZP3022 can be used in anti-diabetic research. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
GLP-1R agonist 9
0 ImagesCat. No.: HY-147622CAS No.: 2401894-00-4GLP-1R agonist 9 (Compound 96) is a GLP-1R agonist with EC50 values of 1.1 nM and 11 nM against CHO GLP-1R Clone H6 and CHO GLP-1R Clone C6, respectively. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
- SDV-Exendin-3/4
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
- FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
Exendin-3/4 (59-86)
0 ImagesExendin-3/4 (59-86) is a Exendin-4 peptide derivative. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
- {Val1}-Exendin-3/4
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
GLP-1R agonist 4
0 ImagesGLP-1R agonist 4 is a glucagon-like peptide-1 (GLP-1) receptor agonist. GLP-1 is an intestinal hypoglycemic hormone secreted by L-cells in the lower gastrointestinal tract. GLP-1R agonist 4 can be used for the research of type 2 diabetes mellitus, obesity, non-alcoholic steatohepatitis, insulin resistance and etc. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
(S,R)-LSN3318839
0 Images(S,R)-LSN3318839 is the stereoisomer of LSN3318839 (HY-142162). LSN3318839 is an orally active positive modulator of the glucagon-like peptide-1 receptor (GLP-1R). LSN3318839 can increase the secretion of insulin and has the effect of lowering blood sugar. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
Zenagamtide
0 ImagesCat. No.: HY-P11274CAS No.: 3005889-81-3Synonyms: Amycretin; NN 9487Zenagamtide (Amycretin; NN 9487) is an orally active, blood-brain barrier permeable triple agonist that targets GLP-1, amylin (Amylin Receptor) and calcitonin receptor (Calcitonin Receptor). Zenagamtide is a single peptide consisting of 68 amino acids that can target brain regions regulating food intake, significantly suppress appetite and reduce energy intake. Therefore, Zenagamtide improves body weight, waist circumference, glycated hemoglobin and lipid profile, and also alleviates the histological features of metabolic dysfunction-associated steatotic liver disease (MASLD) and enhances insulin sensitivity. Zenagamtide may cause transient increases in heart rate and fluctuations in serum calcium levels, but it is an important compound for the study of overweight, obesity, insulin resistance and related metabolic diseases. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
Glucagon receptor antagonist-5
0 ImagesCat. No.: HY-128781CAS No.: 2200274-63-9Glucagon receptor antagonist-5 (compound 13K) is a potent and orally bioavailable indazole-based glucagon receptor antagonist (Ki=32 nM). Glucagon receptor antagonist-5 has potential for the treatment of type 2 diabetes mellitus (T2DM). -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
Retagliptin hydrochloride
0 ImagesCat. No.: HY-112668BCAS No.: 1174038-86-8Synonyms: SP2086 hydrochlorideRetagliptin (SP2086) hydrochloride is a potent inhibitor of beta-amino acids and dipeptidyl peptidase-4 (DPP-4). Retagliptin (SP2086) hydrochloride inhibits type 2 diabetes and improves glycemic control by prolonging the action of intestinal hormones such as glucagon-like peptide-1 (GLP-1). -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
Dasiglucagon
0 ImagesCat. No.: HY-P3469CAS No.: 1544300-84-6Dasiglucagon is a human glucagon analog, and can increase plasma glucose. Dasiglucagon can be used in hypoglycemia research. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
GLP-1 receptor agonist 8
0 ImagesCat. No.: HY-138996CAS No.: 2401892-86-0GLP-1 receptor agonist 8 is a potent agonist of GLP-1 R. GLP-1 receptor agonist 8 has the potential for the research of diabetes, obesity, and nonalcoholic fatty liver disease (NAFLD) (extracted from patent WO2019239319A1, compound 17). -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
FC382K10W15
0 ImagesCat. No.: HY-P5161FC382K10W15 is a glucagon analogue and GLP-1R/GCGR agonist. FC382K10W15 can be used in type 2 diabetes research. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
LY3324954
0 ImagesCat. No.: HY-P11880Purity: 98.89%LY3324954 is a long-acting, highly selective glucagon receptor (GCGR) agonist. LY3324954 stimulates cAMP production via the hepatic GCGR signaling pathway and induces acute blood glucose elevation, while promoting FGF21 expression in the liver and plasma. LY3324954 reduces body weight and abdominal fat mass, increases energy expenditure, and effectively improves lipid homeostasis, insulin sensitivity, and glucose intolerance. LY3324954 can be used in obesity-related research. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
-
A8SGLP-1
0 ImagesCat. No.: HY-P5578CAS No.: 753024-08-7A8SGLP-1 is an orally active GLP-1 analogue that the alanine at position 8 substituted with serine. A8SGLP-1 reduces blood glucose in db/db mice without affecting its function. -
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
- GEP12
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
- Neuropeptide Y, porcine TFA
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
No matching results
No matching results
No matching results
No matching results
-
loading...Please select quantityGet Quote
August 31
-
Please select quantity
August 31
Get Quote
loading... -
No matching results
No matching results
No matching results
No matching results
No matching results
No matching results
No matching results
No matching results
No matching results
No matching results