- Signalwege
- GPCR/G Protein
- GCGR
GCGR
Glucagon Receptor
All Product Categories
-
GCGR Verwandte Produkte (195)
Verwandte Produkte (195)
-
Recombinant Proteins (15)
-
Antibodies (3)
- Exendin (5-39)
-
loading...Please select quantityAngebot einholen
August 31
-
Please select quantity
August 31
Angebot einholen
loading... -
- GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
-
loading...Please select quantityAngebot einholen
August 31
-
Please select quantity
August 31
Angebot einholen
loading... -
- HAEGTFTSD
-
loading...Please select quantityAngebot einholen
August 31
-
Please select quantity
August 31
Angebot einholen
loading... -
-
VU0453379 hydrochloride
0 ImagesArt. -Nr.: HY-116819AReinheit: 99.0%VU0453379 hydrochloride is a highly selective and central nervous system (CNS) penetrant positive allosteric modulator (PAM) of glucagon-like peptide-1R (GLP-1R) with an EC50 of 1.3 μM. -
loading...Please select quantityAngebot einholen
August 31
-
Please select quantity
August 31
Angebot einholen
loading... -
-
[Des-His1,Glu9]-Glucagon amide
0 Images[Des-His1,Glu9]-Glucagon amide is a potent and peptide antagonist of the glucagon receptor, with a pA2 of 7.2. [Des-His1,Glu9]-Glucagon amide is potentially useful in the study of the pathogenesis of diabetes. -
loading...Please select quantityAngebot einholen
August 31
-
Please select quantity
August 31
Angebot einholen
loading... -
- GRPP (human)
-
loading...Please select quantityAngebot einholen
August 31
-
Please select quantity
August 31
Angebot einholen
loading... -
- HAEGTFTSDVS
-
loading...Please select quantityAngebot einholen
August 31
-
Please select quantity
August 31
Angebot einholen
loading... -
-
ZP3022
0 ImagesZP3022 is a dual agonist of glucagon-like peptide-1 (GLP-1) and gastrin that has the ability to sustainably improve glycemic control. Additionally, ZP3022 can effectively increase β-cell mass, promote β-cell proliferation, and enhance the function of pancreatic islets. ZP3022 can be used in anti-diabetic research. -
loading...Please select quantityAngebot einholen
August 31
-
Please select quantity
August 31
Angebot einholen
loading... -
-
GLP-1R agonist 9
0 ImagesArt. -Nr.: HY-147622CAS. Nr.: 2401894-00-4GLP-1R agonist 9 (Compound 96) is a GLP-1R agonist with EC50 values of 1.1 nM and 11 nM against CHO GLP-1R Clone H6 and CHO GLP-1R Clone C6, respectively. -
loading...Please select quantityAngebot einholen
August 31
-
Please select quantity
August 31
Angebot einholen
loading... -
- SDV-Exendin-3/4
-
loading...Please select quantityAngebot einholen
August 31
-
Please select quantity
August 31
Angebot einholen
loading... -
- FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
-
loading...Please select quantityAngebot einholen
August 31
-
Please select quantity
August 31
Angebot einholen
loading... -
-
Exendin-3/4 (59-86)
0 ImagesExendin-3/4 (59-86) is a Exendin-4 peptide derivative. -
loading...Please select quantityAngebot einholen
August 31
-
Please select quantity
August 31
Angebot einholen
loading... -
- {Val1}-Exendin-3/4
-
loading...Please select quantityAngebot einholen
August 31
-
Please select quantity
August 31
Angebot einholen
loading... -
-
GLP-1R agonist 4
0 ImagesGLP-1R agonist 4 is a glucagon-like peptide-1 (GLP-1) receptor agonist. GLP-1 is an intestinal hypoglycemic hormone secreted by L-cells in the lower gastrointestinal tract. GLP-1R agonist 4 can be used for the research of type 2 diabetes mellitus, obesity, non-alcoholic steatohepatitis, insulin resistance and etc. -
loading...Please select quantityAngebot einholen
August 31
-
Please select quantity
August 31
Angebot einholen
loading... -
-
(S,R)-LSN3318839
0 Images(S,R)-LSN3318839 is the stereoisomer of LSN3318839 (HY-142162). LSN3318839 is an orally active positive modulator of the glucagon-like peptide-1 receptor (GLP-1R). LSN3318839 can increase the secretion of insulin and has the effect of lowering blood sugar. -
loading...Please select quantityAngebot einholen
August 31
-
Please select quantity
August 31
Angebot einholen
loading... -
-
Zenagamtide
0 ImagesArt. -Nr.: HY-P11274CAS. Nr.: 3005889-81-3Synonyms: Amycretin; NN 9487Zenagamtide (Amycretin; NN 9487) is an orally active, blood-brain barrier permeable triple agonist that targets GLP-1, amylin (Amylin Receptor) and calcitonin receptor (Calcitonin Receptor). Zenagamtide is a single peptide consisting of 68 amino acids that can target brain regions regulating food intake, significantly suppress appetite and reduce energy intake. Therefore, Zenagamtide improves body weight, waist circumference, glycated hemoglobin and lipid profile, and also alleviates the histological features of metabolic dysfunction-associated steatotic liver disease (MASLD) and enhances insulin sensitivity. Zenagamtide may cause transient increases in heart rate and fluctuations in serum calcium levels, but it is an important compound for the study of overweight, obesity, insulin resistance and related metabolic diseases. -
loading...Please select quantityAngebot einholen
August 31
-
Please select quantity
August 31
Angebot einholen
loading... -
-
Glucagon receptor antagonist-5
0 ImagesArt. -Nr.: HY-128781CAS. Nr.: 2200274-63-9Glucagon receptor antagonist-5 (compound 13K) is a potent and orally bioavailable indazole-based glucagon receptor antagonist (Ki=32 nM). Glucagon receptor antagonist-5 has potential for the treatment of type 2 diabetes mellitus (T2DM). -
loading...Please select quantityAngebot einholen
August 31
-
Please select quantity
August 31
Angebot einholen
loading... -
-
Retagliptin hydrochloride
0 ImagesArt. -Nr.: HY-112668BCAS. Nr.: 1174038-86-8Synonyms: SP2086 hydrochloride -
loading...Please select quantityAngebot einholen
August 31
-
Please select quantity
August 31
Angebot einholen
loading... -
-
Dasiglucagon
0 ImagesArt. -Nr.: HY-P3469CAS. Nr.: 1544300-84-6Dasiglucagon is a human glucagon analog, and can increase plasma glucose. Dasiglucagon can be used in hypoglycemia research. -
loading...Please select quantityAngebot einholen
August 31
-
Please select quantity
August 31
Angebot einholen
loading... -
-
GLP-1 receptor agonist 8
0 ImagesArt. -Nr.: HY-138996CAS. Nr.: 2401892-86-0GLP-1 receptor agonist 8 is a potent agonist of GLP-1 R. GLP-1 receptor agonist 8 has the potential for the research of diabetes, obesity, and nonalcoholic fatty liver disease (NAFLD) (extracted from patent WO2019239319A1, compound 17). -
loading...Please select quantityAngebot einholen
August 31
-
Please select quantity
August 31
Angebot einholen
loading... -
No matching results
No matching results
No matching results
No matching results
-
loading...Please select quantityAngebot einholen
August 31
-
Please select quantity
August 31
Angebot einholen
loading... -
No matching results
No matching results
No matching results
No matching results
No matching results
No matching results
No matching results
No matching results
No matching results
No matching results